Sequences
EST Library Info
dbla2Unavailable
eep1Foetus 50 days, epidermis
eru2Foetus 50 days, regio umbilicalis
fat2Fatt
gul1Gullet
jej1Small intestine, jejunum
lnt1Lymphatic nodule tracheobroncalis
pliv1Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000001036 (click for geneview)
Transcript ID ENST00000002165(link to ensembl)
Symbol FUCA2
Localtion Chromosome:6:143857642:143874530:-1 band: 6q24.2
Description fucosidase, alpha-L- 2, plasma
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--R--P--Q--E--L--P--R--L--A--F--P--L--L--L--L--L--L--L--L--L--P--P--P--P--C--P--A--H--S--A--T--R--
ATGCGGCCCCAGGAGCTCCCCAGGCTCGCGTTCCCGTTGCTGCTGTTGCTGTTGCTGCTGCTGCCGCCGCCGCCGTGCCCTGCCCACAGCGCCACGCGCT
            ::::: ::: :::::      :::.::::::::.:.:: .::::::::         :::: : ::::.::. .:.:::: .:::: :
------------GAGCTGCCCCGGCTC------CCGCTGCTGCTGCTACTTCTGCTGCTG---------CCGCAGGGCCCCGCTGGCGGCGCAGCGCGAT
-------------E--L--P--R--L--------P--L--L--L--L--L--L--L--L-----------P--Q--G--P--A--G--G--A--A--R--

----------------------------------------------------------------------------------------------------
F--D--P--T--W--E--S--L--D--A--R--Q--L--P--A--W--F--D--Q--A--K--F--G--I--F--I--H--W--G--V--F--S--V--P
TCGACCCCACCTGGGAGTCCCTGGACGCCCGCCAGCTGCCCGCGTGGTTTGACCAGGCCAAGTTCGGCATCTTCATCCACTGGGGAGTGTTTTCCGTGCC
::::::::::::::::::::::::::::.::::::.::::::  :::::.::::::::::::::::::::::::::::::::::: :::::.::::::::
TCGACCCCACCTGGGAGTCCCTGGACGCTCGCCAGTTGCCCGGCTGGTTCGACCAGGCCAAGTTCGGCATCTTCATCCACTGGGGCGTGTTCTCCGTGCC
F--D--P--T--W--E--S--L--D--A--R--Q--L--P--G--W--F--D--Q--A--K--F--G--I--F--I--H--W--G--V--F--S--V--P

-----------------------><---------------------------------------------------------------------------
--S--F--G--S--E--W--F--W--W--Y--W--Q--K--E--K--I--P--K--Y--V--E--F--M--K--D--N--Y--P--P--S--F--K--Y-
CAGCTTCGGTAGCGAGTGGTTCTGGTGGTATTGGCAAAAGGAAAAGATACCGAAGTATGTGGAATTTATGAAAGATAATTACCCTCCTAGTTTCAAATAT
:::.::.:: :::::.::::::   ::::::::::::::::::::::: ::.::::::::::: ::.::::::.::::::::::::::..::::: ::::
CAGTTTTGGGAGCGAATGGTTC---TGGTATTGGCAAAAGGAAAAGATTCCAAAGTATGTGGACTTCATGAAAAATAATTACCCTCCTGATTTCACATAT
--S--F--G--S--E--W--F-----W--Y--W--Q--K--E--K--I--P--K--Y--V--D--F--M--K--N--N--Y--P--P--D--F--T--Y-

----------------------------------------------------------------------------------------------------
-E--D--F--G--P--L--F--T--A--K--F--F--N--A--N--Q--W--A--D--I--F--Q--A--S--G--A--K--Y--I--V--L--T--S--
GAAGATTTTGGACCACTATTTACAGCAAAATTTTTTAATGCCAACCAGTGGGCAGATATTTTTCAGGCCTCTGGTGCCAAATACATTGTCTTAACTTCCA
: :::::::::::::: ::::::::: :::::::::.:::: :::::::::::::::::::: :::::.:::::::::::::::::::::::::::::::
GCAGATTTTGGACCACAATTTACAGCCAAATTTTTTGATGCGAACCAGTGGGCAGATATTTTACAGGCTTCTGGTGCCAAATACATTGTCTTAACTTCCA
-A--D--F--G--P--Q--F--T--A--K--F--F--D--A--N--Q--W--A--D--I--L--Q--A--S--G--A--K--Y--I--V--L--T--S--

-----------><---------------------------------------------------------------------------------------
K--H--H--E--G--F--T--L--W--G--S--E--Y--S--W--N--W--N--A--I--D--E--G--P--K--R--D--I--V--K--E--L--E--V
AACATCATGAAGGCTTTACCTTGTGGGGGTCAGAATATTCGTGGAACTGGAATGCCATAGATGAGGGGCCCAAGAGGGACATTGTCAAGGAACTTGAGGT
::::.::::::   ::.::::::::::: :: .:.::.:::::::::::::::::...:::::::::::: ::::::::::::::::::::::::: .::
AACACCATGAA---TTCACCTTGTGGGGCTCCAAGTACTCGTGGAACTGGAATGCTGCAGATGAGGGGCCGAAGAGGGACATTGTCAAGGAACTTGCAGT
K--H--H--E-----F--T--L--W--G--S--K--Y--S--W--N--W--N--A--A--D--E--G--P--K--R--D--I--V--K--E--L--A--V

----------------------------------------------------------------------------------------------------
--A--I--R--N--R--T--D--L--R--F--G--L--Y--Y--S--L--F--E--W--F--H--P--L--F--L--E--D--E--S--S--S--F--H-
AGCCATTAGGAACAGAACTGACCTGCGTTTTGGACTGTACTATTCCCTTTTTGAATGGTTTCATCCGCTCTTCCTTGAGGATGAATCCAGTTCATTCCAT
.::::::::::::::.:::::::::::::::::.::::::::::::::::::::::::::::::::.::::::::::::::.:::::::: :.:::::: 
GGCCATTAGGAACAGGACTGACCTGCGTTTTGGGCTGTACTATTCCCTTTTTGAATGGTTTCATCCACTCTTCCTTGAGGACGAATCCAGGTTATTCCAG
--A--I--R--N--R--T--D--L--R--F--G--L--Y--Y--S--L--F--E--W--F--H--P--L--F--L--E--D--E--S--R--L--F--Q-

----------------------------------------------------------------------------------------------------
-K--R--Q--F--P--V--S--K--T--L--P--E--L--Y--E--L--V--N--N--Y--Q--P--E--V--L--W--S--D--G--D--G--G--A--
AAGCGGCAATTTCCAGTTTCTAAGACATTGCCAGAGCTCTATGAGTTAGTGAACAACTATCAGCCTGAGGTTCTGTGGTCGGATGGTGACGGAGGAGCAC
: .:..::.:::::::: :::::::...:::: :::::.::::::::::::::::  ::::::::::::.:.:: :::::.::.:::::.:::::.:: :
ACACAACAGTTTCCAGTGTCTAAGATGCTGCCTGAGCTTTATGAGTTAGTGAACACATATCAGCCTGAGATCCTCTGGTCAGACGGTGATGGAGGGGCCC
-T--Q--Q--F--P--V--S--K--M--L--P--E--L--Y--E--L--V--N--T--Y--Q--P--E--I--L--W--S--D--G--D--G--G--A--

---------------------------------------------------><-----------------------------------------------
P--D--Q--Y--W--N--S--T--G--F--L--A--W--L--Y--N--E--S--P--V--R--G--T--V--V--T--N--D--R--W--G--A--G--S
CGGATCAATACTGGAACAGCACAGGCTTCTTGGCCTGGTTATATAATGAAAGCCCAGTTCGGGGCACAGTAGTCACCAATGATCGTTGGGGAGCTGGTAG
:.::.   ::.::::::::::::::::::::.::::::.: :::::::::   ::::::::::.::::::.:::::::::::.::.::::::::::::::
CAGACACCTATTGGAACAGCACAGGCTTCTTAGCCTGGCTCTATAATGAA---CCAGTTCGGGACACAGTGGTCACCAATGACCGCTGGGGAGCTGGTAG
P--D--T--Y--W--N--S--T--G--F--L--A--W--L--Y--N--E-----P--V--R--D--T--V--V--T--N--D--R--W--G--A--G--S

----------------------------------------------------------------------------------------------------
--I--C--K--H--G--G--F--Y--T--C--S--D--R--Y--N--P--G--H--L--L--P--H--K--W--E--N--C--M--T--I--D--K--L-
CATCTGTAAGCATGGTGGCTTCTATACCTGCAGTGATCGTTATAACCCAGGACATCTTTTGCCACATAAATGGGAAAACTGCATGACAATAGACAAACTG
:::::::::::::::::::: ::::::::::::::::::::::::.::::::.:.:::::::..::::::::::::::::::::::::::::::::..: 
CATCTGTAAGCATGGTGGCTACTATACCTGCAGTGATCGTTATAATCCAGGATACCTTTTGCTGCATAAATGGGAAAACTGCATGACAATAGACAAGTTT
--I--C--K--H--G--G--Y--Y--T--C--S--D--R--Y--N--P--G--Y--L--L--L--H--K--W--E--N--C--M--T--I--D--K--F-

--------------------------------------------------------------><------------------------------------
-S--W--G--Y--R--R--E--A--G--I--S--D--Y--L--T--I--E--E--L--V--K--Q--L--V--E--T--V--S--C--G--G--N--L--
TCCTGGGGCTATAGGAGGGAAGCTGGAATCTCTGACTATCTTACAATTGAAGAATTGGTGAAGCAACTTGTAGAGACAGTTTCATGTGGAGGAAATCTTT
::::::::::::::::::.: :::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::.:
TCCTGGGGCTATAGGAGGAATGCTGGAATCTCTGACTATCTTACAATTGAAGAATTGGTGAAGCAACTTGTAGAAACAGTTTCATGTGGAGGAAATCTCT
-S--W--G--Y--R--R--N--A--G--I--S--D--Y--L--T--I--E--E--L--V--K--Q--L--V--E--T--V--S--C--G--G--N--L--

----------------------------------------------------------------------------------------------------
L--M--N--I--G--P--T--L--D--G--T--I--S--V--V--F--E--E--R--L--R--Q--M--G--S--W--L--K--V--N--G--E--A--I
TGATGAATATTGGGCCCACACTAGATGGCACCATTTCTGTAGTTTTTGAGGAGCGACTGAGGCAAATGGGGTCCTGGCTAAAAGTCAATGGAGAAGCTAT
::::::::::::::::::::  ::::::::.::::::: . .::::.:::::::::.:.:::::.:::::: ::::::::::::::::.:::::::::::
TGATGAATATTGGGCCCACAAAAGATGGCATCATTTCTCCCATTTTCGAGGAGCGATTAAGGCAGATGGGGACCTGGCTAAAAGTCAACGGAGAAGCTAT
L--M--N--I--G--P--T--K--D--G--I--I--S--P--I--F--E--E--R--L--R--Q--M--G--T--W--L--K--V--N--G--E--A--I

-----------------------------------------------------><---------------------------------------------
--Y--E--T--H--T--W--R--S--Q--N--D--T--V--T--P--D--V--W--Y--T--S--K--P--K--E--K--L--V--Y--A--I--F--L-
TTATGAAACCCATACCTGGCGATCCCAGAATGACACTGTCACCCCAGATGTGTGGTACACATCCAAGCCTAAAGAAAAATTAGTCTATGCCATTTTTCTT
.::::::::::.:.:.::: ::::::::::::::::::::::.:::::::::   ::.::::::::.::::::.. :: ::.::::::::. : :::::.
CTATGAAACCCGTGCTTGGAGATCCCAGAATGACACTGTCACTCCAGATGTG---TATACATCCAAACCTAAAAGCAATTTGGTCTATGCTCTGTTTCTC
--Y--E--T--R--A--W--R--S--Q--N--D--T--V--T--P--D--V-----Y--T--S--K--P--K--S--N--L--V--Y--A--L--F--L-

--------------------------------------------------------------><------------------------------------
-K--W--P--T--S--G--Q--L--F--L--G--H--P--K--A--I--L--G--A--T--E--V--K--L--L--G--H--G--Q--P--L--N--W--
AAATGGCCCACATCAGGACAGCTGTTCCTTGGCCATCCCAAAGCTATTCTGGGGGCAACAGAGGTGAAACTACTGGGCCATGGACAGCCACTTAACTGGA
::.:::::::::::::::::::::.:.::::..:: ::::::::::.:::::::::::::::::: ::::::::::: ::::::::::::::::::::::
AAGTGGCCCACATCAGGACAGCTGCTTCTTGATCAGCCCAAAGCTACTCTGGGGGCAACAGAGGTTAAACTACTGGGACATGGACAGCCACTTAACTGGA
-K--W--P--T--S--G--Q--L--L--L--D--Q--P--K--A--T--L--G--A--T--E--V--K--L--L--G--H--G--Q--P--L--N--W--

----------------------------------------------------------------------------------------------------
I--S--L--E--Q--N--G--I--M--V--E--L--P--Q--L--T--I--H--Q--M--P--C--K--W--G--W--A--L--A--L--T--N--V--I
TTTCTTTGGAGCAAAATGGCATTATGGTAGAACTGCCACAGCTAACCATTCATCAGATGCCGTGTAAATGGGGCTGGGCTCTAGCCCTGACTAATGTGAT
.::::::::::: ::: :::::.:.:::.:::::::: :: :::::: ::::::::::::: :::.::::::::::::::::::: ::.: ::::::::.
CTTCTTTGGAGCCAAAGGGCATCACGGTGGAACTGCCTCATCTAACCTTTCATCAGATGCCCTGTGAATGGGGCTGGGCTCTAGCACTAAGTAATGTGAC
T--S--L--E--P--K--G--I--T--V--E--L--P--H--L--T--F--H--Q--M--P--C--E--W--G--W--A--L--A--L--S--N--V--T

--->
--*-
CTAA
::::
CTAA
--*-

Pig Consensus Sequence

>BGISUST0000895928
------------GAGCTGCCCCGGCTCCCGCTGCTGCTGCTACTTCTGCTGCTGCCGCAGGGCCCCGCTGGCGGCGCAGCGCGATTCGACCCCACCTGGG
AGTCCCTGGACGCTCGCCAGTTGCCCGGCTGGTTCGACCAGGCCAAGTTCGGCATCTTCATCCACTGGGGCGTGTTCTCCGTGCCCAGTTTTGGGAGCGA
ATGGTTC---TGGTATTGGCAAAAGGAAAAGATTCCAAAGTATGTGGACTTCATGAAAAATAATTACCCTCCTGATTTCACATATGCAGATTTTGGACCA
CAATTTACAGCCAAATTTTTTGATGCGAACCAGTGGGCAGATATTTTACAGGCTTCTGGTGCCAAATACATTGTCTTAACTTCCAAACACCATGAA---T
TCACCTTGTGGGGCTCCAAGTACTCGTGGAACTGGAATGCTGCAGATGAGGGGCCGAAGAGGGACATTGTCAAGGAACTTGCAGTGGCCATTAGGAACAG
GACTGACCTGCGTTTTGGGCTGTACTATTCCCTTTTTGAATGGTTTCATCCACTCTTCCTTGAGGACGAATCCAGGTTATTCCAGACACAACAGTTTCCA
GTGTCTAAGATGCTGCCTGAGCTTTATGAGTTAGTGAACACATATCAGCCTGAGATCCTCTGGTCAGACGGTGATGGAGGGGCCCCAGACACCTATTGGA
ACAGCACAGGCTTCTTAGCCTGGCTCTATAATGAA---CCAGTTCGGGACACAGTGGTCACCAATGACCGCTGGGGAGCTGGTAGCATCTGTAAGCATGG
TGGCTACTATACCTGCAGTGATCGTTATAATCCAGGATACCTTTTGCTGCATAAATGGGAAAACTGCATGACAATAGACAAGTTTTCCTGGGGCTATAGG
AGGAATGCTGGAATCTCTGACTATCTTACAATTGAAGAATTGGTGAAGCAACTTGTAGAAACAGTTTCATGTGGAGGAAATCTCTTGATGAATATTGGGC
CCACAAAAGATGGCATCATTTCTCCCATTTTCGAGGAGCGATTAAGGCAGATGGGGACCTGGCTAAAAGTCAACGGAGAAGCTATCTATGAAACCCGTGC
TTGGAGATCCCAGAATGACACTGTCACTCCAGATGTG---TATACATCCAAACCTAAAAGCAATTTGGTCTATGCTCTGTTTCTCAAGTGGCCCACATCA
GGACAGCTGCTTCTTGATCAGCCCAAAGCTACTCTGGGGGCAACAGAGGTTAAACTACTGGGACATGGACAGCCACTTAACTGGACTTCTTTGGAGCCAA
AGGGCATCACGGTGGAACTGCCTCATCTAACCTTTCATCAGATGCCCTGTGAATGGGGCTGGGCTCTAGCACTAAGTAATGTGACCTAA


>BGISUSP0000895928
----ELPRLPLLLLLLLLPQGPAGGAARFDPTWESLDARQLPGWFDQAKFGIFIHWGVFSVPSFGSEWF-WYWQKEKIPKYVDFMKNNYPPDFTYADFGP
QFTAKFFDANQWADILQASGAKYIVLTSKHHE-FTLWGSKYSWNWNAADEGPKRDIVKELAVAIRNRTDLRFGLYYSLFEWFHPLFLEDESRLFQTQQFP
VSKMLPELYELVNTYQPEILWSDGDGGAPDTYWNSTGFLAWLYNE-PVRDTVVTNDRWGAGSICKHGGYYTCSDRYNPGYLLLHKWENCMTIDKFSWGYR
RNAGISDYLTIEELVKQLVETVSCGGNLLMNIGPTKDGIISPIFEERLRQMGTWLKVNGEAIYETRAWRSQNDTVTPDV-YTSKPKSNLVYALFLKWPTS
GQLLLDQPKATLGATEVKLLGHGQPLNWTSLEPKGITVELPHLTFHQMPCEWGWALALSNVT*