Sequences
EST Library Info
aor1Aorta
cje2Jejunum - RNA from China
cly2Lymph - RNA from China
cst3Stomach - RNA from China
dbla1Unavailable
eye1Foetus 50 days, Eye
hea1Heart
jej1Small intestine, jejunum
lnt1Lymphatic nodule tracheobroncalis
mgm1Mammary gland - 14 days after birth
nje2Newborn 115 days, jejunum
sin1Small intestine
sme1M. Semimembranosus
spl1Spleen
sto3Stomach
Clusters
Oligos
SNPs

Gene ID ENSG00000008324 (click for geneview)
Transcript ID ENST00000011691(link to ensembl)
Symbol SS18L2
Localtion Chromosome:3:42607296:42611484:1 band: 3p22.1
Description SS18-like protein 2 (SYT homolog-2). [Source:Uniprot/SWISSPROT;Acc:Q9UHA2]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-------------------------------------------------------------------><------------------------------
-M--S--V--A--F--V--P--D--W--L--R--G--K--A--E--V--N--Q--E--T--I--Q--R--L--L--E--E--N--D--Q--L--I--R--
ATGTCGGTGGCCTTCGTACCGGACTGGCTGAGGGGCAAGGCGGAAGTCAATCAAGAGACTATCCAGCGGCTCCTTGAGGAGAATGACCAGCTGATCCGCT
:::::::::::::::::::: :::: :.::::.:::::::::::::::..:::.::::::::::::::::::.: :::::::::::::::::::::::::
ATGTCGGTGGCCTTCGTACCCGACTCGTTGAGAGGCAAGGCGGAAGTCGGTCAGGAGACTATCCAGCGGCTCTTAGAGGAGAATGACCAGCTGATCCGCT
-M--S--V--A--F--V--P--D--S--L--R--G--K--A--E--V--G--Q--E--T--I--Q--R--L--L--E--E--N--D--Q--L--I--R--

---------------------------------------------><-----------------------------------------------------
C--I--V--E--Y--Q--N--K--G--R--G--N--E--C--V--Q--Y--Q--H--V--L--H--R--N--L--I--Y--L--A--T--I--A--D--A
GTATTGTGGAGTATCAGAACAAGGGCCGCGGGAACGAGTGCGTGCAGTACCAGCATGTGTTACATAGAAATCTCATTTATTTGGCTACCATTGCAGATGC
::::.:::::.:::::::::::.::::: :  ::.::::::      :::::::::::::::::.::::::::::::::::::::::::::.::::::::
GTATCGTGGAATATCAGAACAAAGGCCGGGCTAATGAGTGC------TACCAGCATGTGTTACACAGAAATCTCATTTATTTGGCTACCATCGCAGATGC
C--I--V--E--Y--Q--N--K--G--R--A--N--E--C--------Y--Q--H--V--L--H--R--N--L--I--Y--L--A--T--I--A--D--A

--------------------------------->
--S--P--T--S--T--S--K--A--M--E--*-
CAGTCCAACCAGCACTTCAAAAGCAATGGAATAA
::..::::::::...:::::::::::::::::::
CAACCCAACCAGTGTTTCAAAAGCAATGGAATAA
--N--P--T--S--V--S--K--A--M--E--*-

Pig Consensus Sequence

>BGISUST0000893918
ATGTCGGTGGCCTTCGTACCCGACTCGTTGAGAGGCAAGGCGGAAGTCGGTCAGGAGACTATCCAGCGGCTCTTAGAGGAGAATGACCAGCTGATCCGCT
GTATCGTGGAATATCAGAACAAAGGCCGGGCTAATGAGTGC------TACCAGCATGTGTTACACAGAAATCTCATTTATTTGGCTACCATCGCAGATGC
CAACCCAACCAGTGTTTCAAAAGCAATGGAATAA


>BGISUSP0000893918
MSVAFVPDSLRGKAEVGQETIQRLLEENDQLIRCIVEYQNKGRANEC--YQHVLHRNLIYLATIADANPTSVSKAME*