Sequences
EST Library Info
ebs3Foetus 50 days, brain stem
eep1Foetus 50 days, epidermis
fat1Fatt
lin2Large intestine
mgp2Mammary gland - 7 days pre birth
nlu1Newborn 115 days, lung
pliv2Unavailable
ret2Retina
spl1Spleen
uio3Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000034693 (click for geneview)
Transcript ID ENST00000036971(link to ensembl)
Symbol PEX3
Localtion Chromosome:6:143813810:143852834:1 band: 6q24.2
Description Peroxisomal biogenesis factor 3 (Peroxin-3) (Peroxisomal assembly protein PEX3). [Source:Uniprot/SWISSPROT;Acc:P56589]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-----------------------------------------------------------------------><--------------------------
-M--L--R--S--V--W--N--F--L--K--R--H--K--K--K--C--I--F--L--G--T--V--L--G--G--V--Y--I--L--G--K--Y--G--
ATGCTGAGGTCTGTATGGAATTTTCTGAAACGCCACAAAAAGAAATGCATCTTCCTGGGCACGGTCCTTGGAGGAGTATATATTCTGGGGAAATATGGAC
::::::::.:::...:::::::::::::::::.:::::::::::::::::::::::::: ::::::::.:::   .:::::::.::::::::::::::::
ATGCTGAGATCTACGTGGAATTTTCTGAAACGTCACAAAAAGAAATGCATCTTCCTGGGGACGGTCCTCGGA---ATATATATCCTGGGGAAATATGGAC
-M--L--R--S--T--W--N--F--L--K--R--H--K--K--K--C--I--F--L--G--T--V--L--G-----I--Y--I--L--G--K--Y--G--

----------------------------------------------------------------------------------------------------
Q--K--K--I--R--E--I--Q--E--R--E--A--A--E--Y--I--A--Q--A--R--R--Q--Y--H--F--E--S--N--Q--R--T--C--N--M
AGAAGAAAATCAGAGAAATACAGGAAAGGGAGGCTGCAGAATACATTGCCCAAGCACGACGACAATATCATTTTGAAAGTAACCAGAGGACTTGCAATAT
::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::
AGAAGAAAATCAGAGAAATACAAGAAAGGGAGGCTGCAGAATACATTGCCCAAGCACGACGACAGTATCATTTTGAAAGTAACCAGAGGACTTGCAATAT
Q--K--K--I--R--E--I--Q--E--R--E--A--A--E--Y--I--A--Q--A--R--R--Q--Y--H--F--E--S--N--Q--R--T--C--N--M

----><--------------------------------------------------------------------------------><------------
--T--V--L--S--M--L--P--T--L--R--E--A--L--M--Q--Q--L--N--S--E--S--L--T--A--L--L--K--N--R--P--S--N--K-
GACAGTGCTGTCCATGCTTCCAACACTGAGAGAGGCCTTAATGCAGCAACTGAATTCCGAGAGCCTCACAGCTCTGCTAAAAAACAGGCCTTCAAACAAG
::::   :::::::::::::::::::::::::::::::::::::::::::: :::::.::::::::.::::.:::::::::::::   ::::::::::::
GACA---CTGTCCATGCTTCCAACACTGAGAGAGGCCTTAATGCAGCAACTCAATTCTGAGAGCCTTACAGTTCTGCTAAAAAAC---CCTTCAAACAAG
--T-----L--S--M--L--P--T--L--R--E--A--L--M--Q--Q--L--N--S--E--S--L--T--V--L--L--K--N-----P--S--N--K-

------------------------------><--------------------------------------------------------------------
-L--E--I--W--E--D--L--K--I--I--S--F--T--R--S--T--V--A--V--Y--S--T--C--M--L--V--V--L--L--R--V--Q--L--
CTAGAAATATGGGAGGATCTGAAGATAATAAGTTTCACAAGAAGTACTGTGGCTGTATACAGTACCTGTATGCTGGTTGTTCTTTTGCGGGTCCAGTTAA
::::::::::::::::::::::::::::::   :::::::::::::..::.::::::::::::::.::.::::::::::::::::::::.::.:::::::
CTAGAAATATGGGAGGATCTGAAGATAATA---TTCACAAGAAGTATCGTAGCTGTATACAGTACTTGCATGCTGGTTGTTCTTTTGCGAGTTCAGTTAA
-L--E--I--W--E--D--L--K--I--I-----F--T--R--S--I--V--A--V--Y--S--T--C--M--L--V--V--L--L--R--V--Q--L--

-------------------------------------------------------><-------------------------------------------
N--I--I--G--G--Y--I--Y--L--D--N--A--A--V--G--K--N--G--T--T--I--L--A--P--P--D--V--Q--Q--Q--Y--L--S--S
ACATAATTGGTGGATATATTTACCTGGATAATGCAGCAGTTGGCAAAAATGGCACTACAATTCTTGCTCCCCCAGATGTCCAACAGCAGTATTTATCAAG
:::::::.:::::::::::::::::::::::::::::::::::::::::::::   :::.::::::::::::::::::::::::::::::::::.:::::
ACATAATCGGTGGATATATTTACCTGGATAATGCAGCAGTTGGCAAAAATGGC---ACAGTTCTTGCTCCCCCAGATGTCCAACAGCAGTATTTGTCAAG
N--I--I--G--G--Y--I--Y--L--D--N--A--A--V--G--K--N--G-----T--V--L--A--P--P--D--V--Q--Q--Q--Y--L--S--S

----------------------><-----------------------------------------------------><---------------------
--I--Q--H--L--L--G--D--G--L--T--E--L--I--T--V--I--K--Q--A--V--Q--K--V--L--G--S--V--S--L--K--H--S--L-
TATTCAGCACCTACTTGGAGATGGCCTGACAGAATTGATCACTGTCATTAAACAAGCTGTGCAGAAGGTTTTAGGAAGTGTTTCTCTTAAACATTCTTTG
:::.::.::::: :::::::::   :::::::::::::::::::::::::::::: :::::::::::.::::::::   :::::::::::::::::::::
TATCCAACACCTCCTTGGAGAT---CTGACAGAATTGATCACTGTCATTAAACAATCTGTGCAGAAGATTTTAGGA---GTTTCTCTTAAACATTCTTTG
--I--Q--H--L--L--G--D-----L--T--E--L--I--T--V--I--K--Q--S--V--Q--K--I--L--G-----V--S--L--K--H--S--L-

----------------------------------------------------------------------------------------------------
-S--L--L--D--L--E--Q--K--L--K--E--I--R--N--L--V--E--Q--H--K--S--S--S--W--I--N--K--D--G--S--K--P--L--
TCCCTTTTGGACTTGGAGCAAAAACTAAAAGAAATCAGAAATCTCGTTGAGCAGCATAAGTCTTCTTCTTGGATTAATAAAGATGGATCCAAACCTTTAT
::.::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::.:.::::::
TCTCTTTTGGACTTGGAGCAAAAACTAAAAGAAATCAGAGATCTCGTTGAGCAGCATAAGTCTTCTTCTTGGATTAATAAAGATGGATCCAGATCTTTAT
-S--L--L--D--L--E--Q--K--L--K--E--I--R--D--L--V--E--Q--H--K--S--S--S--W--I--N--K--D--G--S--R--S--L--

----------------------------------------------><----------------------------------------------------
L--C--H--Y--M--M--P--D--E--E--T--P--L--A--V--Q--A--C--G--L--S--P--R--D--I--T--T--I--K--L--L--N--E--T
TATGCCATTATATGATGCCAGATGAAGAAACTCCATTAGCAGTGCAGGCCTGTGGACTTTCTCCTCGAGACATTACCACTATTAAACTTCTCAATGAAAC
:.::::::::::::::::::::::::::::::::::::::::: :::::::::::.::::::::: ::::..:::::::::::::::: :::::::::::
TGTGCCATTATATGATGCCAGATGAAGAAACTCCATTAGCAGTTCAGGCCTGTGGGCTTTCTCCTAGAGATGTTACCACTATTAAACTACTCAATGAAAC
L--C--H--Y--M--M--P--D--E--E--T--P--L--A--V--Q--A--C--G--L--S--P--R--D--V--T--T--I--K--L--L--N--E--T

-----------------><---------------------------------------------------------------------------------
--R--D--M--L--E--S--P--D--F--S--T--V--L--N--T--C--L--N--R--G--F--S--R--L--L--D--N--M--A--E--F--F--R-
TAGAGACATGTTGGAAAGCCCAGATTTTAGTACAGTTTTGAATACCTGTTTAAACCGAGGTTTTAGTAGACTTCTAGACAATATGGCTGAGTTCTTTCGA
::::::::::::::::   ::::::::::::::.::::::::::.::::::.:::::::: :::::.::.:: :::::::::::::::::::::::.:::
TAGAGACATGTTGGAA---CCAGATTTTAGTACGGTTTTGAATATCTGTTTGAACCGAGGATTTAGCAGGCTGCTAGACAATATGGCTGAGTTCTTCCGA
--R--D--M--L--E-----P--D--F--S--T--V--L--N--I--C--L--N--R--G--F--S--R--L--L--D--N--M--A--E--F--F--R-

----------------------------------------><----------------------------------------------------------
-P--T--E--Q--D--L--Q--H--G--N--S--M--N--S--L--S--S--V--S--L--P--L--A--K--I--I--P--I--V--N--G--Q--I--
CCTACTGAACAGGACCTGCAACATGGTAACTCTATGAATAGTCTTTCCAGTGTCAGCCTGCCTTTAGCTAAGATAATTCCAATAGTAAACGGACAGATCC
::::::::.:::::::: ::::::::::::::.: ::::   ::::::::::::::::::::::::::::::::::::::::::.::::.::::::::::
CCTACTGAGCAGGACCTCCAACATGGTAACTCCAGGAAT---CTTTCCAGTGTCAGCCTGCCTTTAGCTAAGATAATTCCAATAATAAATGGACAGATCC
-P--T--E--Q--D--L--Q--H--G--N--S--R--N-----L--S--S--V--S--L--P--L--A--K--I--I--P--I--I--N--G--Q--I--

-------------------------------------><-------------------------------------------------------------
H--S--V--C--S--E--T--P--S--H--F--V--Q--D--L--L--T--M--E--Q--V--K--D--F--A--A--N--V--Y--E--A--F--S--T
ATTCAGTTTGCAGTGAAACACCTAGTCATTTTGTTCAGGATCTGTTGACAATGGAGCAAGTGAAAGACTTTGCTGCTAATGTGTATGAAGCTTTTAGTAC
::::::::::::::::::::::::::::::::::::::::::::::::..:::::::::::::::::.::::::::.:::::::::::.:::::::::::
ATTCAGTTTGCAGTGAAACACCTAGTCATTTTGTTCAGGATCTGTTGATGATGGAGCAAGTGAAAGATTTTGCTGCCAATGTGTATGAGGCTTTTAGTAC
H--S--V--C--S--E--T--P--S--H--F--V--Q--D--L--L--M--M--E--Q--V--K--D--F--A--A--N--V--Y--E--A--F--S--T

--------------------->
--P--Q--Q--L--E--K--*-
CCCTCAGCAACTGGAGAAATGA
.:::::.:::::::::::::::
TCCTCAACAACTGGAGAAATGA
--P--Q--Q--L--E--K--*-

Pig Consensus Sequence

>BGISUST0000902292
ATGCTGAGATCTACGTGGAATTTTCTGAAACGTCACAAAAAGAAATGCATCTTCCTGGGGACGGTCCTCGGA---ATATATATCCTGGGGAAATATGGAC
AGAAGAAAATCAGAGAAATACAAGAAAGGGAGGCTGCAGAATACATTGCCCAAGCACGACGACAGTATCATTTTGAAAGTAACCAGAGGACTTGCAATAT
GACA---CTGTCCATGCTTCCAACACTGAGAGAGGCCTTAATGCAGCAACTCAATTCTGAGAGCCTTACAGTTCTGCTAAAAAAC---CCTTCAAACAAG
CTAGAAATATGGGAGGATCTGAAGATAATA---TTCACAAGAAGTATCGTAGCTGTATACAGTACTTGCATGCTGGTTGTTCTTTTGCGAGTTCAGTTAA
ACATAATCGGTGGATATATTTACCTGGATAATGCAGCAGTTGGCAAAAATGGC---ACAGTTCTTGCTCCCCCAGATGTCCAACAGCAGTATTTGTCAAG
TATCCAACACCTCCTTGGAGAT---CTGACAGAATTGATCACTGTCATTAAACAATCTGTGCAGAAGATTTTAGGA---GTTTCTCTTAAACATTCTTTG
TCTCTTTTGGACTTGGAGCAAAAACTAAAAGAAATCAGAGATCTCGTTGAGCAGCATAAGTCTTCTTCTTGGATTAATAAAGATGGATCCAGATCTTTAT
TGTGCCATTATATGATGCCAGATGAAGAAACTCCATTAGCAGTTCAGGCCTGTGGGCTTTCTCCTAGAGATGTTACCACTATTAAACTACTCAATGAAAC
TAGAGACATGTTGGAA---CCAGATTTTAGTACGGTTTTGAATATCTGTTTGAACCGAGGATTTAGCAGGCTGCTAGACAATATGGCTGAGTTCTTCCGA
CCTACTGAGCAGGACCTCCAACATGGTAACTCCAGGAAT---CTTTCCAGTGTCAGCCTGCCTTTAGCTAAGATAATTCCAATAATAAATGGACAGATCC
ATTCAGTTTGCAGTGAAACACCTAGTCATTTTGTTCAGGATCTGTTGATGATGGAGCAAGTGAAAGATTTTGCTGCCAATGTGTATGAGGCTTTTAGTAC
TCCTCAACAACTGGAGAAATGA


>BGISUSP0000902292
MLRSTWNFLKRHKKKCIFLGTVLG-IYILGKYGQKKIREIQEREAAEYIAQARRQYHFESNQRTCNMT-LSMLPTLREALMQQLNSESLTVLLKN-PSNK
LEIWEDLKII-FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNAAVGKNG-TVLAPPDVQQQYLSSIQHLLGD-LTELITVIKQSVQKILG-VSLKHSL
SLLDLEQKLKEIRDLVEQHKSSSWINKDGSRSLLCHYMMPDEETPLAVQACGLSPRDVTTIKLLNETRDMLE-PDFSTVLNICLNRGFSRLLDNMAEFFR
PTEQDLQHGNSRN-LSSVSLPLAKIIPIINGQIHSVCSETPSHFVQDLLMMEQVKDFAANVYEAFSTPQQLEK*