Sequences
EST Library Info
ste2M. Semitendinosus
tes2Testes
Clusters
Oligos
SNPs

Gene ID ENSG00000089163 (click for geneview)
Transcript ID ENST00000202967(link to ensembl)
Symbol SIRT4_HUMAN
Localtion Chromosome:12:119202883:119213767:1 band: 12q24.23
Description NAD-dependent deacetylase sirtuin 4 (EC 3.5.1.-) (SIR2-like protein 4).
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--K--M--S--F--A--L--T--F--R--S--A--K--G--R--W--I--A--N--P--S--Q--P--C--S--K--A--S--I--G--L--F--V--
ATGAAGATGAGCTTTGCGTTGACTTTCAGGTCAGCAAAAGGCCGTTGGATCGCAAACCCCAGCCAGCCGTGCTCGAAAGCCTCCATTGGGTTATTTGTGC
::::.:::::::::::  ::.:.:::.::: :::::::::::::.::::: ::::: :.:::::.:: ::::::. . :  : ::.::..::.:::::::
ATGAGGATGAGCTTTGGCTTAATTTTTAGGACAGCAAAAGGCCGCTGGATGGCAAAGCTCAGCCGGCAGTGCTCACGTGGATACACTGAATTGTTTGTGC
-M--R--M--S--F--G--L--I--F--R--T--A--K--G--R--W--M--A--K--L--S--R--Q--C--S--R--G--Y--T--E--L--F--V--

----------------------------------------------------------------------------------------------------
P--A--S--P--P--L--D--P--E--K--V--K--E--L--Q--R--F--I--T--L--S--K--R--L--L--V--M--T--G--A--G--I--S--T
CAGCAAGTCCTCCTCTGGACCCTGAGAAGGTCAAAGAGTTACAGCGCTTCATCACCCTTTCCAAGAGACTCCTTGTGATGACTGGGGCAGGAATCTCCAC
:: :.:::::::::.::::::::::::::::::::::::: ::::::::.:::::::::::::::::::: :: :::::::::::.::::::::::::::
CATCGAGTCCTCCTTTGGACCCTGAGAAGGTCAAAGAGTTCCAGCGCTTTATCACCCTTTCCAAGAGACTGCTAGTGATGACTGGAGCAGGAATCTCCAC
P--S--S--P--P--L--D--P--E--K--V--K--E--F--Q--R--F--I--T--L--S--K--R--L--L--V--M--T--G--A--G--I--S--T

----------------------------------------------------------------------------------------------------
--E--S--G--I--P--D--Y--R--S--E--K--V--G--L--Y--A--R--T--D--R--R--P--I--Q--H--G--D--F--V--R--S--A--P-
CGAATCGGGGATACCAGACTACAGGTCAGAAAAAGTGGGGCTTTATGCCCGCACTGACCGCAGGCCCATCCAGCATGGTGATTTTGTCCGGAGTGCCCCA
.::.:::::::: ::::::::::::::::::::.:::::.:::::::::::::: ::::: ::::::::::::::::: :::::::: :::::.::.:::
TGAGTCGGGGATTCCAGACTACAGGTCAGAAAAGGTGGGACTTTATGCCCGCACAGACCGGAGGCCCATCCAGCATGGGGATTTTGTACGGAGCGCTCCA
--E--S--G--I--P--D--Y--R--S--E--K--V--G--L--Y--A--R--T--D--R--R--P--I--Q--H--G--D--F--V--R--S--A--P-

----------------------------------------------------------------------------------------------------
-I--R--Q--R--Y--W--A--R--N--F--V--G--W--P--Q--F--S--S--H--Q--P--N--P--A--H--W--A--L--S--T--W--E--K--
ATCCGCCAGCGGTACTGGGCGAGAAACTTCGTAGGCTGGCCTCAATTCTCCTCCCACCAGCCTAACCCTGCACACTGGGCTTTGAGCACCTGGGAGAAAC
::::::::.:::::::::::.::::::::.::::::::::::::.::::::::.:::::::::::::::::::::::::::::::::: ::::::::.::
ATCCGCCAACGGTACTGGGCAAGAAACTTTGTAGGCTGGCCTCAGTTCTCCTCTCACCAGCCTAACCCTGCACACTGGGCTTTGAGCAACTGGGAGAGAC
-I--R--Q--R--Y--W--A--R--N--F--V--G--W--P--Q--F--S--S--H--Q--P--N--P--A--H--W--A--L--S--N--W--E--R--

------------------------------------------------------------------------------------------------><--
L--G--K--L--Y--W--L--V--T--Q--N--V--D--A--L--H--T--K--A--G--S--R--R--L--T--E--L--H--G--C--M--D--R--V
TCGGAAAGCTGTACTGGTTGGTGACCCAAAATGTGGATGCTTTGCACACCAAGGCGGGGAGTCGGCGCCTGACAGAGCTCCACGGATGCATGGACAGGGT
: ::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::.::::::::::::.:::::.:::::::::      ::
TGGGAAAGCTGTACTGGTTGGTGACCCAAAATGTGGATGCCTTGCACACCAAGGCGGGGAGTCAGCGCCTGACAGAACTCCATGGATGCATG------GT
L--G--K--L--Y--W--L--V--T--Q--N--V--D--A--L--H--T--K--A--G--S--Q--R--L--T--E--L--H--G--C--M--------V

----------------------------------------------------------------------------------------------------
--L--C--L--D--C--G--E--Q--T--P--R--G--V--L--Q--E--R--F--Q--V--L--N--P--T--W--S--A--E--A--H--G--L--A-
CCTGTGCTTGGATTGTGGGGAACAGACTCCCCGGGGGGTGCTGCAAGAGCGTTTCCAAGTCCTGAACCCCACCTGGAGTGCTGAGGCCCATGGCCTGGCT
::: ::::::::.::::: ::.::::::::::: .::::::::::.::::: ::. ::::::::::::::::::::::.:::::::::::.:::::::::
CCTCTGCTTGGACTGTGGCGAGCAGACTCCCCGCAGGGTGCTGCAGGAGCGGTTTGAAGTCCTGAACCCCACCTGGAGCGCTGAGGCCCACGGCCTGGCT
--L--C--L--D--C--G--E--Q--T--P--R--R--V--L--Q--E--R--F--E--V--L--N--P--T--W--S--A--E--A--H--G--L--A-

----------------------------------------------------------------------------------------------------
-P--D--G--D--V--F--L--S--E--E--Q--V--R--S--F--Q--V--P--T--C--V--Q--C--G--G--H--L--K--P--D--V--V--F--
CCTGATGGTGACGTCTTTCTCTCAGAGGAGCAAGTCCGGAGCTTTCAGGTCCCAACCTGCGTTCAATGTGGAGGCCATCTGAAACCAGATGTCGTTTTCT
:: ::.:::::.::::::::: : ::::::::.:: :.::::::.::::::::: ::::: .::.::::::::::: .::::::::::::::.::.::::
CCGGACGGTGATGTCTTTCTCACCGAGGAGCAGGTACAGAGCTTCCAGGTCCCATCCTGCTCTCGATGTGGAGGCCCCCTGAAACCAGATGTTGTCTTCT
-P--D--G--D--V--F--L--T--E--E--Q--V--Q--S--F--Q--V--P--S--C--S--R--C--G--G--P--L--K--P--D--V--V--F--

-------------------------------------------------------------------------------------------><-------
F--G--D--T--V--N--P--D--K--V--D--F--V--H--K--R--V--K--E--A--D--S--L--L--V--V--G--S--S--L--Q--V--Y--S
TCGGGGACACAGTGAACCCTGACAAGGTTGATTTTGTGCACAAGCGTGTAAAAGAAGCCGACTCCCTCTTGGTGGTGGGATCATCCTTGCAGGTATACTC
::::::::::.:::::::::.::: .:: :::::::::::::::::::::::::::::.:::::.:::.::::::::::.::::::::::::::.:::::
TCGGGGACACGGTGAACCCTAACACAGTGGATTTTGTGCACAAGCGTGTAAAAGAAGCTGACTCTCTCCTGGTGGTGGGGTCATCCTTGCAGGTGTACTC
F--G--D--T--V--N--P--N--T--V--D--F--V--H--K--R--V--K--E--A--D--S--L--L--V--V--G--S--S--L--Q--V--Y--S

----------------------------------------------------------------------------------------------------
--G--Y--R--F--I--L--T--A--W--E--K--K--L--P--I--A--I--L--N--I--G--P--T--R--S--D--D--L--A--C--L--K--L-
TGGTTACAGGTTTATCCTCACTGCCTGGGAGAAGAAGCTCCCGATTGCAATACTGAACATTGGGCCCACACGGTCGGATGACTTGGCGTGTCTGAAACTG
.:::::::.:::::::::::: ::...::::::.::::: :: :::::::::.::::::::::::::::::::::::::.:::::::.: ::::::::::
CGGTTACAAGTTTATCCTCACAGCTCAGGAGAAAAAGCTGCCCATTGCAATATTGAACATTGGGCCCACACGGTCGGATAACTTGGCATCTCTGAAACTG
--G--Y--K--F--I--L--T--A--Q--E--K--K--L--P--I--A--I--L--N--I--G--P--T--R--S--D--N--L--A--S--L--K--L-

-------------------------------------------->
-N--S--R--C--G--E--L--L--P--L--I--D--P--C--*-
AATTCTCGTTGTGGAGAGTTGCTGCCTTTGATAGACCCATGCTGA
.:::: :::::::::::::::::::::::.:::::::::..::::
GATTCACGTTGTGGAGAGTTGCTGCCTTTAATAGACCCACACTGA
-D--S--R--C--G--E--L--L--P--L--I--D--P--H--*-

Pig Consensus Sequence

>BGISUST0000888553
ATGAGGATGAGCTTTGGCTTAATTTTTAGGACAGCAAAAGGCCGCTGGATGGCAAAGCTCAGCCGGCAGTGCTCACGTGGATACACTGAATTGTTTGTGC
CATCGAGTCCTCCTTTGGACCCTGAGAAGGTCAAAGAGTTCCAGCGCTTTATCACCCTTTCCAAGAGACTGCTAGTGATGACTGGAGCAGGAATCTCCAC
TGAGTCGGGGATTCCAGACTACAGGTCAGAAAAGGTGGGACTTTATGCCCGCACAGACCGGAGGCCCATCCAGCATGGGGATTTTGTACGGAGCGCTCCA
ATCCGCCAACGGTACTGGGCAAGAAACTTTGTAGGCTGGCCTCAGTTCTCCTCTCACCAGCCTAACCCTGCACACTGGGCTTTGAGCAACTGGGAGAGAC
TGGGAAAGCTGTACTGGTTGGTGACCCAAAATGTGGATGCCTTGCACACCAAGGCGGGGAGTCAGCGCCTGACAGAACTCCATGGATGCATG------GT
CCTCTGCTTGGACTGTGGCGAGCAGACTCCCCGCAGGGTGCTGCAGGAGCGGTTTGAAGTCCTGAACCCCACCTGGAGCGCTGAGGCCCACGGCCTGGCT
CCGGACGGTGATGTCTTTCTCACCGAGGAGCAGGTACAGAGCTTCCAGGTCCCATCCTGCTCTCGATGTGGAGGCCCCCTGAAACCAGATGTTGTCTTCT
TCGGGGACACGGTGAACCCTAACACAGTGGATTTTGTGCACAAGCGTGTAAAAGAAGCTGACTCTCTCCTGGTGGTGGGGTCATCCTTGCAGGTGTACTC
CGGTTACAAGTTTATCCTCACAGCTCAGGAGAAAAAGCTGCCCATTGCAATATTGAACATTGGGCCCACACGGTCGGATAACTTGGCATCTCTGAAACTG
GATTCACGTTGTGGAGAGTTGCTGCCTTTAATAGACCCACACTGA


>BGISUSP0000888553
MRMSFGLIFRTAKGRWMAKLSRQCSRGYTELFVPSSPPLDPEKVKEFQRFITLSKRLLVMTGAGISTESGIPDYRSEKVGLYARTDRRPIQHGDFVRSAP
IRQRYWARNFVGWPQFSSHQPNPAHWALSNWERLGKLYWLVTQNVDALHTKAGSQRLTELHGCM--VLCLDCGEQTPRRVLQERFEVLNPTWSAEAHGLA
PDGDVFLTEEQVQSFQVPSCSRCGGPLKPDVVFFGDTVNPNTVDFVHKRVKEADSLLVVGSSLQVYSGYKFILTAQEKKLPIAILNIGPTRSDNLASLKL
DSRCGELLPLIDPH*