Sequences
EST Library Info
cga2Galactophore - RNA from China
csp2Spleen - RNA from China
ecc2Foetus 50 days, cortex cerebri
eru2Foetus 50 days, regio umbilicalis
fat1Fatt
jca1Joint capsule
lnt1Lymphatic nodule tracheobroncalis
med3Mediastinum
nmm1Newborn 115 days, mucosal membranes
plac1Unavailable
ssp1M. Supraspinatus
Clusters
Oligos
SNPs

Gene ID ENSG00000090238 (click for geneview)
Transcript ID ENST00000204279(link to ensembl)
Symbol YPEL3
Localtion Chromosome:16:30011141:30014437:-1 band: 16p11.2
Description Yippee-like protein 3 (DiGeorge syndrome-related protein FKSG5).
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<----------------------------------------------------------------------><---------------------------
-M--Q--P--E--A--S--S--L--S--Q--N--R--D--A--S--G--P--R--R--G--C--W--L--W--R--R--E--Q--P--S--V--T--E--
ATGCAACCTGAGGCCTCCTCACTGAGTCAAAACCGAGACGCCTCTGGTCCCCGGAGAGGCTGCTGGCTCTGGAGGAGAGAGCAGCCCAGTGTGACAGAGC
                  ::: :::::::::::.::: :: ::::::.:.:.:::::::::::::::::   :::::: ::::::: :::::::::::: 
------------------TCAGTGAGTCAAAACTGAGCCGGCTCTGGCCTCTGGAGAGGCTGCTGGCTC---AGGAGACAGCAGCCAAGTGTGACAGAGA
-------------------S--V--S--Q--N--*--A--G--S--G--L--W--R--G--C--W--L-----R--R--Q--Q--P--S--V--T--E--

----------------------------------------------------------------------------------------------------
R--V--P--T--A--L--G--V--P--R--M--C--V--A--Q--V--L--T--A--H--L--L--P--P--R--Q--A--L--G--S--L--C--S--P
GAGTCCCCACGGCTCTGGGAGTGCCTCGCATGTGTGTGGCCCAGGTCCTGACAGCCCACCTACTCCCTCCCCGGCAGGCACTGGGCTCCCTCTGCTCCCC
:::::::::.:::.: ::: ::::::    :::::::::::::::::.::::::::: :.:.::::::.::: :::::::::::::::::::::::::::
GAGTCCCCATGGCCCAGGGCGTGCCTGC-CTGTGTGTGGCCCAGGTCTTGACAGCCCCCTTGCTCCCTTCCCTGCAGGCACTGGGCTCCCTCTGCTCCCC
R--V--P--M--A--Q--G--V--P--R--L--C--V--A--Q--V--L--T--A--P--L--L--P--S--L--Q--A--L--G--S--L--C--S--P

----------------------------------------------------------------------------------------------------
--W--A--A--P--R--V--G--P--L--P--P--A--P--A--M--V--R--I--S--K--P--K--T--F--Q--A--Y--L--D--D--C--H--R-
GTGGGCCGCTCCCCGCGTGGGGCCACTGCCCCCGGCCCCCGCCATGGTGCGGATTTCAAAGCCCAAGACGTTTCAGGCCTACTTGGATGATTGTCACCGG
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
GTGGGCCGCTCCCCGCGTGGGGCCACTGCCCCCGGCCCCCGCCATGGTGCGGATTTCAAAGCCCAAGACGTTTCAGGCCTACTTGGATGATTGTCACCGG
--W--A--A--P--R--V--G--P--L--P--P--A--P--A--M--V--R--I--S--K--P--K--T--F--Q--A--Y--L--D--D--C--H--R-

--------------------------------------------------------------><------------------------------------
-R--Y--S--C--A--H--C--R--A--H--L--A--N--H--D--D--L--I--S--K--S--F--Q--G--S--Q--G--R--A--Y--L--F--N--
AGGTATAGCTGTGCCCACTGCCGCGCTCACCTGGCCAACCACGACGACCTCATCTCCAAGTCCTTCCAGGGCAGTCAGGGGCGTGCCTACCTCTTCAACT
:::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::.::::::::.:::::::::::::::::::::::: 
AGGTATAGCTGTGCCCACTGCCGTGCTCACCTGGCCAACCACGACGACCTCATCTCCAAGTCCTTTCAGGGCAGCCAGGGGCGTGCCTACCTCTTCAAC-
-R--Y--S--C--A--H--C--R--A--H--L--A--N--H--D--D--L--I--S--K--S--F--Q--G--S--Q--G--R--A--Y--L--F--N--

------><--------------------------------------------------------------------------------------------
S--V--V--N--V--G--C--G--P--A--E--E--R--V--L--L--T--G--L--H--A--V--A--D--I--H--C--E--N--C--K--T--T--L
CAGTGGTGAACGTGGGCTGCGGGCCAGCCGAGGAGCGGGTGCTGCTGACCGGCCTCCATGCTGTCGCCGACATCCACTGCGAGAACTGCAAGACCACTTT
     :::::::::::::::::::::::::::::::::::::::::::: :::::::::::::::::.::::::::::::::.:::::::::::::::::
-----GTGAACGTGGGCTGCGGGCCAGCCGAGGAGCGGGTGCTGCTGACGGGCCTCCATGCTGTCGCTGACATCCACTGCGAAAACTGCAAGACCACTTT
------V--N--V--G--C--G--P--A--E--E--R--V--L--L--T--G--L--H--A--V--A--D--I--H--C--E--N--C--K--T--T--L

---------------><-----------------------------------------------------------------------------------
--G--W--K--Y--E--Q--A--F--E--S--S--Q--K--Y--K--E--G--K--Y--I--I--E--L--N--H--M--I--K--D--N--G--W--D-
GGGCTGGAAATATGAACAGGCCTTTGAGAGCAGCCAGAAGTACAAAGAGGGGAAGTACATCATTGAACTCAACCACATGATCAAAGACAACGGCTGGGAC
::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::
GGGCTGGAAATATGAACAGGCCTTCGAGAGCAGCCAGAAGTACAAAGAGGGGAAGTACATCATTGAACTCAACCACATGATCAAAGACAATGGCTGGGAC
--G--W--K--Y--E--Q--A--F--E--S--S--Q--K--Y--K--E--G--K--Y--I--I--E--L--N--H--M--I--K--D--N--G--W--D-

---
-*-
TGA
:::
TGA
-*-

Pig Consensus Sequence

>BGISUST0000880100
------------------TCAGTGAGTCAAAACTGAGCCGGCTCTGGCCTCTGGAGAGGCTGCTGGCTC---AGGAGACAGCAGCCAAGTGTGACAGAGA
GAGTCCCCATGGCCCAGGGCGTGCCtcTGTGTGTGGCCCAGGTCTTGACAGCCCCCTTGCTCCCTTCCCTGCAGGCACTGGGCTCCCTCTGCTCCCCGTG
GGCCGCTCCCCGCGTGGGGCCACTGCCCCCGGCCCCCGCCATGGTGCGGATTTCAAAGCCCAAGACGTTTCAGGCCTACTTGGATGATTGTCACCGGAGG
TATAGCTGTGCCCACTGCCGTGCTCACCTGGCCAACCACGACGACCTCATCTCCAAGTCCTTTCAGGGCAGCCAGGGGCGTGCCTACCTCTTCAAC----
--GTGAACGTGGGCTGCGGGCCAGCCGAGGAGCGGGTGCTGCTGACGGGCCTCCATGCTGTCGCTGACATCCACTGCGAAAACTGCAAGACCACTTTGGG
CTGGAAATATGAACAGGCCTTCGAGAGCAGCCAGAAGTACAAAGAGGGGAAGTACATCATTGAACTCAACCACATGATCAAAGACAATGGCTGGGACTGA


>BGISUSP0000880100
------SVSQN*AGSGLWRGCWL-RRQQPSVTERVPMAQGVPLCVAQVLTAPLLPSLQALGSLCSPWAAPRVGPLPPAPAMVRISKPKTFQAYLDDCHRR
YSCAHCRAHLANHDDLISKSFQGSQGRAYLFN--VNVGCGPAEERVLLTGLHAVADIHCENCKTTLGWKYEQAFESSQKYKEGKYIIELNHMIKDNGWD*