Sequences
EST Library Info
che1Heart - RNA from China
ese3Foetus 50 days, M. semitendinosus
jej2Small intestine, jejunum
nmm1Newborn 115 days, mucosal membranes
pgl2Pituitary gland
pldo2Unavailable
sme1M. Semimembranosus
ute2Uterus
Clusters
Oligos
SNPs

Gene ID ENSG00000096153 (click for geneview)
Transcript ID ENST00000211377(link to ensembl)
Symbol BAT4
Localtion Chromosome:6:31736985:31742039:-1 band: 6p21.33
Description Protein BAT4 (HLA-B-associated transcript 4) (G5 protein). [Source:Uniprot/SWISSPROT;Acc:O95872]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--S--R--P--L--L--I--T--F--T--P--A--T--D--P--S--D--L--W--K--D--G--Q--Q--Q--P--Q--P--E--K--P--E--S--
ATGTCCCGGCCCTTGCTCATCACCTTCACCCCAGCCACTGACCCCAGCGACCTCTGGAAGGATGGGCAGCAGCAGCCACAGCCCGAGAAGCCAGAGTCCA
:::::: ::.:::. :::::.: :::.::::::::::::::::::::.::.::::::::.::::::::.: ::::.:::: ::.::..:::..:::.:::
ATGTCCGGGTCCTCCCTCATTAACTTTACCCCAGCCACTGACCCCAGTGATCTCTGGAAAGATGGGCAACTGCAGTCACACCCTGAAGAGCTGGAGCCCA
-M--S--G--S--S--L--I--N--F--T--P--A--T--D--P--S--D--L--W--K--D--G--Q--L--Q--S--H--P--E--E--L--E--P--

----------------------------------------------------------------------------------------------------
T--L--D--G--A--A--A--R--A--F--Y--E--A--L--I--G--D--E--S--S--A--P--D--S--Q--R--S--Q--T--E--P--A--R--E
CCCTGGATGGGGCTGCAGCCCGAGCTTTCTATGAGGCCCTGATTGGGGATGAGAGCAGCGCTCCTGACTCCCAGAGATCTCAGACTGAACCTGCCAGAGA
::::::::::::::::::::::.:::::::::::.::..::::::::::.:::..::::.:.::::: .:::::::::::::: ::::.:::::.     
CCCTGGATGGGGCTGCAGCCCGGGCTTTCTATGAAGCTTTGATTGGGGACGAGGACAGCACCCCTGAGCCCCAGAGATCTCAGCCTGAGCCTGCT-----
T--L--D--G--A--A--A--R--A--F--Y--E--A--L--I--G--D--E--D--S--T--P--E--P--Q--R--S--Q--P--E--P--A------

----------------------------------------------------------------------------------------------------
--R--K--R--K--K--R--R--I--M--K--A--P--A--A--E--A--V--A--E--G--A--S--G--R--H--G--Q--G--R--S--L--E--A-
AAGAAAGAGAAAGAAAAGAAGAATAATGAAGGCACCAGCAGCAGAAGCAGTGGCAGAAGGAGCATCAGGAAGACATGGACAAGGGAGATCCCTTGAGGCT
 ::::::::.::::::::: :::..::::.:: . : .:::::               ::::::::::::..: ::::::::.:::::::::::::::: 
-AGAAAGAGGAAGAAAAGACGAACGATGAGGGAGACTACAGCA---------------GGAGCATCAGGAGAAGATGGACAAAGGAGATCCCTTGAGGCA
--R--K--R--K--K--R--R--T--M--R--E--T--T--A-----------------G--A--S--G--E--D--G--Q--R--R--S--L--E--A-

----------------------------------------------------------------------------------------------------
-E--D--K--M--T--H--R--I--L--R--A--A--Q--E--G--D--L--P--E--L--R--R--L--L--E--P--H--E--A--G--G--A--G--
GAGGATAAGATGACTCACCGGATACTGAGGGCAGCCCAGGAGGGGGACCTGCCAGAACTTAGGAGACTGCTGGAACCGCATGAGGCAGGAGGAGCTGGGG
:::::.::::::::.:: :.::::::::::::::::::::::::::::::: ::.:::: :..:..:::.:::: :: :::::::::::.::::::::.:
GAGGACAAGATGACCCAGCAGATACTGAGGGCAGCCCAGGAGGGGGACCTGGCAAAACTGAAAAAGCTGTTGGATCCCCATGAGGCAGGGGGAGCTGGAG
-E--D--K--M--T--Q--Q--I--L--R--A--A--Q--E--G--D--L--A--K--L--K--K--L--L--D--P--H--E--A--G--G--A--G--

----------------------------------------------------------------------------------------------------
G--N--I--N--A--R--D--A--F--W--W--T--P--L--M--C--A--A--R--A--G--Q--G--A--A--V--S--Y--L--L--G--R--G--A
GGAATATCAACGCCCGGGATGCCTTCTGGTGGACCCCACTGATGTGTGCTGCTCGAGCGGGCCAGGGGGCAGCTGTGAGCTATCTCCTGGGCCGTGGGGC
:::::::::::::.::.:::::.:::::::::::::::::::::::::::::.:::::.:::::::::::::::::: ::::::::::::::::::::::
GGAATATCAACGCTCGAGATGCTTTCTGGTGGACCCCACTGATGTGTGCTGCCCGAGCAGGCCAGGGGGCAGCTGTGCGCTATCTCCTGGGCCGTGGGGC
G--N--I--N--A--R--D--A--F--W--W--T--P--L--M--C--A--A--R--A--G--Q--G--A--A--V--R--Y--L--L--G--R--G--A

----------------------------------------------------------------------------------------------------
--A--W--V--G--V--C--E--L--S--G--R--D--A--A--Q--L--A--E--E--A--G--F--P--E--V--A--R--M--V--R--E--S--H-
TGCCTGGGTGGGGGTCTGTGAGCTGAGTGGCAGGGATGCGGCTCAGCTCGCTGAAGAAGCTGGCTTCCCTGAGGTAGCCCGCATGGTCAGGGAGAGCCAT
 :::::::::::::::::.::::::.::::::::::::: :::::::: :: :::::::: :::::::::::.::.::::::::::::::.::::::: .
GGCCTGGGTGGGGGTCTGCGAGCTGGGTGGCAGGGATGCTGCTCAGCTGGCGGAAGAAGCAGGCTTCCCTGAAGTGGCCCGCATGGTCAGAGAGAGCCCC
--A--W--V--G--V--C--E--L--G--G--R--D--A--A--Q--L--A--E--E--A--G--F--P--E--V--A--R--M--V--R--E--S--P-

-------------------------><-------------------------------------------------------------------------
-G--E--T--R--S--P--E--N--R--S--P--T--P--S--L--Q--Y--C--E--N--C--D--T--H--F--Q--D--S--N--H--R--T--S--
GGAGAGACAAGGAGCCCGGAAAACCGGTCTCCTACTCCCTCCCTCCAGTACTGCGAGAACTGTGACACCCACTTCCAAGATTCCAACCACCGCACATCCA
::::::::::::::.::.::.:::   .:.:   :.:.:::::.:::::::::.:::: ::::::..:::::::::::::.::.::::::::.:::::::
GGAGAGACAAGGAGTCCAGAGAAC---CCCCGATCCCTCTCCCCCCAGTACTGTGAGACCTGTGATGCCCACTTCCAAGACTCTAACCACCGTACATCCA
-G--E--T--R--S--P--E--N-----P--R--S--L--S--P--Q--Y--C--E--T--C--D--A--H--F--Q--D--S--N--H--R--T--S--

----------------------------------------------------------------------------------------------------
T--A--H--L--L--S--L--S--Q--G--P--Q--P--P--N--L--P--L--G--V--P--I--S--S--P--G--F--K--L--L--L--R--G--G
CTGCTCACCTGCTGTCACTGTCGCAGGGTCCTCAGCCTCCCAACCTTCCACTTGGGGTGCCCATCTCCAGCCCGGGCTTCAAACTGCTGCTGAGGGGGGG
:.::::::::::: :::::::: :.::.::..:::::.:::::::: :: :::::::::::.:.:::::::::.:::::.::.:: :: ::.::::::::
CCGCTCACCTGCTCTCACTGTCCCGGGATCTCCAGCCCCCCAACCTGCCCCTTGGGGTGCCTACCTCCAGCCCAGGCTTTAAGCTTCTCCTAAGGGGGGG
T--A--H--L--L--S--L--S--R--D--L--Q--P--P--N--L--P--L--G--V--P--T--S--S--P--G--F--K--L--L--L--R--G--G

----------------------------------------------------------------------------------------------------
--W--E--P--G--M--G--L--G--P--R--G--E--G--R--A--N--P--I--P--T--V--L--K--R--D--Q--E--G--L--G--Y--R--S-
CTGGGAGCCAGGAATGGGGCTGGGACCCCGGGGTGAGGGCCGTGCCAATCCCATCCCCACTGTCCTCAAGAGGGACCAGGAAGGACTAGGCTACAGATCA
.:::::::: :::: :::.::::::::::..::: :.:::::::::::.::::::::::::::::::::.:::::::::::::::.:::::::.::::::
TTGGGAGCCTGGAAAGGGACTGGGACCCCAAGGTCAAGGCCGTGCCAACCCCATCCCCACTGTCCTCAAAAGGGACCAGGAAGGATTAGGCTATAGATCA
--W--E--P--G--K--G--L--G--P--Q--G--Q--G--R--A--N--P--I--P--T--V--L--K--R--D--Q--E--G--L--G--Y--R--S-

----------------------------------------------------------------------------------------------------
-A--P--Q--P--R--V--T--H--F--P--A--W--D--T--R--A--V--A--G--R--E--R--P--P--R--V--A--T--L--S--W--R--E--
GCACCCCAGCCCCGAGTGACACATTTCCCAGCTTGGGATACCCGAGCTGTGGCTGGGAGGGAGAGACCCCCTCGGGTGGCCACACTGAGCTGGAGGGAGG
::: ::::.:::::::: :::::::::.::::::::::::: ::.:: ::::: :::::::::::: .:::: :. ::.:::::::::.:..::.::::.
GCAGCCCAACCCCGAGTTACACATTTCTCAGCTTGGGATACACGGGCGGTGGCAGGGAGGGAGAGAGTCCCTAGATTGACCACACTGAACCAGAAGGAGA
-A--A--Q--P--R--V--T--H--F--S--A--W--D--T--R--A--V--A--G--R--E--R--V--P--R--L--T--T--L--N--Q--K--E--

---------------------------------------------------------------------->
E--R--R--R--E--E--K--D--R--A--W--E--R--D--L--R--T--Y--M--N--L--E--F--*-
AGAGAAGGAGGGAGGAGAAAGACAGGGCTTGGGAGCGGGATCTAAGGACTTACATGAACCTCGAGTTCTGA
:::::::: .:::::::::.:::::.::.::::::::::::::.::::: ::::::::.::.::.::::::
AGAGAAGGCAGGAGGAGAAGGACAGAGCCTGGGAGCGGGATCTGAGGACATACATGAATCTTGAATTCTGA
K--R--R--Q--E--E--K--D--R--A--W--E--R--D--L--R--T--Y--M--N--L--E--F--*-

Pig Consensus Sequence

>BGISUST0000898277
ATGTCCGGGTCCTCCCTCATTAACTTTACCCCAGCCACTGACCCCAGTGATCTCTGGAAAGATGGGCAACTGCAGTCACACCCTGAAGAGCTGGAGCCCA
CCCTGGATGGGGCTGCAGCCCGGGCTTTCTATGAAGCTTTGATTGGGGACGAGGACAGCACCCCTGAGCCCCAGAGATCTCAGCCTGAGCCTGCTAGAAA
GAGGAAGAAAAGACGAACGATGAGGGAGACTACAGCAGGAGCATCAGGAGAAGATGGACAAAGGAGATCCCTTGAGGCAGAGGACAAGATGACCCAGCAG
ATACTGAGGGCAGCCCAGGAGGGGGACCTGGCAAAACTGAAAAAGCTGTTGGATCCCCATGAGGCAGGGGGAGCTGGAGGGAATATCAACGCTCGAGATG
CTTTCTGGTGGACCCCACTGATGTGTGCTGCCCGAGCAGGCCAGGGGGCAGCTGTGCGCTATCTCCTGGGCCGTGGGGCGGCCTGGGTGGGGGTCTGCGA
GCTGGGTGGCAGGGATGCTGCTCAGCTGGCGGAAGAAGCAGGCTTCCCTGAAGTGGCCCGCATGGTCAGAGAGAGCCCCGGAGAGACAAGGAGTCCAGAG
AAC---CCCCGATCCCTCTCCCCCCAGTACTGTGAGACCTGTGATGCCCACTTCCAAGACTCTAACCACCGTACATCCACCGCTCACCTGCTCTCACTGT
CCCGGGATCTCCAGCCCCCCAACCTGCCCCTTGGGGTGCCTACCTCCAGCCCAGGCTTTAAGCTTCTCCTAAGGGGGGGTTGGGAGCCTGGAAAGGGACT
GGGACCCCAAGGTCAAGGCCGTGCCAACCCCATCCCCACTGTCCTCAAAAGGGACCAGGAAGGATTAGGCTATAGATCAGCAGCCCAACCCCGAGTTACA
CATTTCTCAGCTTGGGATACACGGGCGGTGGCAGGGAGGGAGAGAGTCCCTAGATTGACCACACTGAACCAGAAGGAGAAGAGAAGGCAGGAGGAGAAGG
ACAGAGCCTGGGAGCGGGATCTGAGGACATACATGAATCTTGAATTCTGA


>BGISUSP0000898277
MSGSSLINFTPATDPSDLWKDGQLQSHPEELEPTLDGAAARAFYEALIGDEDSTPEPQRSQPEPARKRKKRRTMRETTAGASGEDGQRRSLEAEDKMTQQ
ILRAAQEGDLAKLKKLLDPHEAGGAGGNINARDAFWWTPLMCAARAGQGAAVRYLLGRGAAWVGVCELGGRDAAQLAEEAGFPEVARMVRESPGETRSPE
N-PRSLSPQYCETCDAHFQDSNHRTSTAHLLSLSRDLQPPNLPLGVPTSSPGFKLLLRGGWEPGKGLGPQGQGRANPIPTVLKRDQEGLGYRSAAQPRVT
HFSAWDTRAVAGRERVPRLTTLNQKEKRRQEEKDRAWERDLRTYMNLEF*