Sequences
EST Library Info
cad3Unavailable
cga3Galactophore - RNA from China
cli1Liver - RNA from China
cov1Ovary - RNA from China
csp3Spleen - RNA from China
ecc2Foetus 50 days, cortex cerebri
eep2Foetus 50 days, epidermis
eje1Foetus 50 days, jejunum
eru2Foetus 50 days, regio umbilicalis
ese4Foetus 50 days, M. semitendinosus
eye1Foetus 50 days, Eye
fhi2Unavailable
hyp2Hypothalamus
jca1Joint capsule
med2Mediastinum
nbm1Newborn 115 days, bone marrow (pelvis)
pigcb2Unavailable
plac12Unavailable
pldo1Unavailable
ton4Tip of tongue, mucosal membrane
Clusters
Oligos
SNPs

Gene ID ENSG00000096155 (click for geneview)
Transcript ID ENST00000211379(link to ensembl)
Symbol BAT3
Localtion Chromosome:6:31714797:31728426:-1 band: 6p21.33
Description Large proline-rich protein BAT3 (HLA-B-associated transcript 3) (G3). [Source:Uniprot/SWISSPROT;Acc:P46379]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--E--P--N--D--S--T--S--T--A--V--E--E--P--D--S--L--E--V--L--V--K--T--L--D--S--Q--T--R--T--F--I--V--
ATGGAGCCTAATGATAGTACCAGTACCGCTGTGGAGGAGCCTGACAGCTTGGAGGTGTTGGTGAAGACCTTGGACTCTCAAACTCGTACCTTTATTGTGG
::::::::.::::::::::::::::::.::.::::.:::::::: :::.::::::::.:::::::::::.::::::::::.::.:: :::::::::::::
ATGGAGCCCAATGATAGTACCAGTACCACTATGGAAGAGCCTGAAAGCCTGGAGGTGCTGGTGAAGACCCTGGACTCTCAGACCCGGACCTTTATTGTGG
-M--E--P--N--D--S--T--S--T--T--M--E--E--P--E--S--L--E--V--L--V--K--T--L--D--S--Q--T--R--T--F--I--V--

-------><-------------------------------------------------------------------------------------------
G--A--Q--M--N--V--K--E--F--K--E--H--I--A--A--S--V--S--I--P--S--E--K--Q--R--L--I--Y--Q--G--R--V--L--Q
GGGCCCAGATGAATGTAAAAGAGTTTAAGGAGCACATTGCTGCCTCTGTCAGCATCCCATCTGAAAAACAACGGCTCATTTACCAGGGACGAGTTCTGCA
:::::::::::::::::::.:::::::::::::::::::::::::::::::::::::: :::::.:::::::::::.::.:::::::: :: ::::::::
GGGCCCAGATGAATGTAAAGGAGTTTAAGGAGCACATTGCTGCCTCTGTCAGCATCCCTTCTGAGAAACAACGGCTTATCTACCAGGGCCGTGTTCTGCA
G--A--Q--M--N--V--K--E--F--K--E--H--I--A--A--S--V--S--I--P--S--E--K--Q--R--L--I--Y--Q--G--R--V--L--Q

-------------------------><-------------------------------------------------------------------------
--D--D--K--K--L--Q--E--Y--N--V--G--G--K--V--I--H--L--V--E--R--A--P--P--Q--T--H--L--P--S--G--A--S--S-
AGATGATAAGAAGCTTCAGGAATACAATGTTGGGGGAAAGGTTATCCACCTGGTGGAACGGGCTCCTCCTCAGACTCACCTCCCTTCTGGGGCATCTTCT
.::::::::::::::.:::::::::   :::::.:::::.::::::::::: :::::::::::::::::::::::::: :::::::: ::::::::::::
GGATGATAAGAAGCTCCAGGAATAC---GTTGGAGGAAAAGTTATCCACCTTGTGGAACGGGCTCCTCCTCAGACTCAGCTCCCTTCAGGGGCATCTTCT
--D--D--K--K--L--Q--E--Y-----V--G--G--K--V--I--H--L--V--E--R--A--P--P--Q--T--Q--L--P--S--G--A--S--S-

----------------------------------------------------------------------------------------------------
-G--T--G--S--A--S--A--T--H--G--G--G--S--P--P--G--T--R--G--P--G--A--S--V--H--D--R--N--A--N--S--Y--V--
GGGACGGGGTCTGCCTCAGCCACTCATGGTGGGGGATCCCCCCCTGGTACTCGGGGGCCTGGGGCCTCTGTTCATGACCGGAATGCCAACAGCTATGTCA
::.::.:::::::::::::::::.::::::::::::.:::: ::::::::::::::::::::::::::.:: ::::::::::::::::::::::::::::
GGAACAGGGTCTGCCTCAGCCACCCATGGTGGGGGACCCCCACCTGGTACTCGGGGGCCTGGGGCCTCCGTGCATGACCGGAATGCCAACAGCTATGTCA
-G--T--G--S--A--S--A--T--H--G--G--G--P--P--P--G--T--R--G--P--G--A--S--V--H--D--R--N--A--N--S--Y--V--

----------------------><----------------------------------------------------><----------------------
M--V--G--T--F--N--L--P--S--D--G--S--A--V--D--V--H--I--N--M--E--Q--A--P--I--Q--S--E--P--R--V--R--L--V
TGGTTGGAACCTTCAATCTTCCTAGTGACGGCTCTGCTGTGGATGTTCACATCAACATGGAACAGGCCCCGATTCAGAGTGAGCCCCGGGTACGGCTGGT
::::::::::::::::::::   :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:: ::::::::
TGGTTGGAACCTTCAATCTT---AGTGACGGCTCTGCTGTGGATGTTCACATCAACATGGAACAGGCCCCGATTCAGAGTGAGCCCCGAGTCCGGCTGGT
M--V--G--T--F--N--L-----S--D--G--S--A--V--D--V--H--I--N--M--E--Q--A--P--I--Q--S--E--P--R--V--R--L--V

---------------------------------------------------><-----------------------------------------------
--M--A--Q--H--M--I--R--D--I--Q--T--L--L--S--R--M--E--S--Y--P--A--F--G--I--L--------T--L--P-----Y--L-
GATGGCTCAGCACATGATCAGGGATATACAGACCTTACTATCCCGGATGGAGTCTTACCCTGCCTTTGGTATCCTG------ACTCTCCCC---TACCTT
::::::::::::::::::::::::.::::::::::::::.:::::::::::::::.:.::::.::: :::.::::       :::::::::    :::::
GATGGCTCAGCACATGATCAGGGACATACAGACCTTACTGTCCCGGATGGAGTCTCATCCTGTCTTGGGTGTCCTTGTCCTGACTCTCCCCT--GACCTT
--M--A--Q--H--M--I--R--D--I--Q--T--L--L--S--R--M--E--S--H--P--V--L--G--V--L--V--L--T--L--P--\--Y--L-

----------------------------------------------------------------------------------------------------
-Q--C--R--G--G--P--Q--P--Q--H--S--Q--P--P--P--Q--P--P--A--V--T--P--E--P--V--A--L--S--S--Q--T--S--E--
CAGTGTCGAGGAGGGCCCCAACCGCAGCACAGTCAGCCGCCCCCGCAGCCACCGGCTGTGACCCCGGAGCCAGTAGCCTTGAGCTCTCAAACATCAGAAC
:::::.:: ::.:::.::::: :.::::::::::::::.:::.::::: ..::..:::: .::::::::::.:::::::::::::::::::::::::::.
CAGTGCCGCGGGGGGTCCCAAGCACAGCACAGTCAGCCACCCTCGCAGATGCCAACTGTCGCCCCGGAGCCGGTAGCCTTGAGCTCTCAAACATCAGAAT
-Q--C--R--G--G--S--Q--A--Q--H--S--Q--P--P--S--Q--M--P--T--V--A--P--E--P--V--A--L--S--S--Q--T--S--E--

----------------------------------------------------------------------------------------------------
P--V--E--S--E--A--P--P--R--E--P--M--E--A--E--E--V--E--E--R--A--P--A--Q--N--P--E--L--T--P-----G--P--A
CAGTTGAAAGTGAAGCACCTCCCCGGGAGCCCATGGAGGCAGAAGAAGTGGAGGAGCGTGCCCCAGCCCAGAACCCGGAGCTCACTCCT---GGCCCAGC
: ::.:::::.::::..::::::::::::::::::: ::::::::::::::::::::: :::.: :::::::.:::::.::::: ::::   ::::::::
CCGTCGAAAGCGAAGTGCCTCCCCGGGAGCCCATGGCGGCAGAAGAAGTGGAGGAGCGGGCCTCTGCCCAGAGCCCGGGGCTCAGTCCTTCTGGCCCAGC
S--V--E--S--E--V--P--P--R--E--P--M--A--A--E--E--V--E--E--R--A--S--A--Q--S--P--G--L--S--P--S--G--P--A

-----------------------------------------><---------------------------------------------------------
--P--A--G--P--T--P--A--P--E--T--N--A--P--N--H--P--S--P--A--E--Y--V--E--V--L--Q--E--L--Q--R--L--E--S-
CCCAGCGGGCCCAACACCTGCCCCGGAAACAAATGCACCCAACCATCCTTCCCCTGCGGAGTATGTCGAGGTGCTCCAGGAGCTACAGCGGCTGGAGAGT
::::::::::::::::::::: ::.::.::::::::::::   ::.:::::::::::::::::.::::: :::.: :::::::: :::::::: :::::.
CCCAGCGGGCCCAACACCTGCGCCAGAGACAAATGCACCC---CACCCTTCCCCTGCGGAGTACGTCGA-GTGTT-CAGGAGCTCCAGCGGCTTGAGAGC
--P--A--G--P--T--P--A--P--E--T--N--A--P-----H--P--S--P--A--E--Y--V--E--V--L--Q--E--L--Q--R--L--E--S-

--------------------------------------------------------------------------------><------------------
-R--L--Q--P--F--L--Q--R--Y--Y--E--V--L--G--A--A--A--T--T--D--Y--N--N--N--H--E--G--R--E--E--D--Q--R--
CGCCTCCAGCCCTTCTTGCAGCGCTACTACGAGGTTCTGGGTGCTGCTGCCACCACGGACTACAATAACAATCACGAGGGCCGGGAGGAGGATCAGCGGT
:::::::::::::::.:::::::::::::.:: ::::::::.::.::::::::::::::::::::.:::   :: :::: ::: ::.:::::.::::: :
CGCCTCCAGCCCTTCCTGCAGCGCTACTATGA-GTTCTGGGCGCCGCTGCCACCACGGACTACAACAAC---CAAGAGGCCCGCGAAGAGGACCAGCGCT
-R--L--Q--P--F--L--Q--R--Y--Y--E--V--L--G--A--A--A--T--T--D--Y--N--N-----Q--E--A--R--E--E--D--Q--R--

----------------------------------------------------------------------------------------------------
L--I--N--L--V--G--E--S--L--R--L--L--G--N--T--F--V--A--L--S--D--L--R--C--N--L--A--C--T--P--P--R--H--L
TGATCAACTTGGTAGGGGAGAGCCTGCGACTGCTGGGCAACACCTTTGTTGCACTGTCTGACCTGCGCTGCAATCTGGCCTGCACGCCCCCACGACACCT
:::::::::::::.::.:::::::::::.:::::::::::::::::::: ::.::::::::::::::::::::.::::::::..:::: :: ::.:::::
TGATCAACTTGGTGGGAGAGAGCCTGCGGCTGCTGGGCAACACCTTTGTGGCGCTGTCTGACCTGCGCTGCAACCTGGCCTGTGCGCCGCCTCGGCACCT
L--I--N--L--V--G--E--S--L--R--L--L--G--N--T--F--V--A--L--S--D--L--R--C--N--L--A--C--A--P--P--R--H--L

------------------------------------------------------------------------------><--------------------
--H--V--V--R--P--M--S--H--Y--T--T--P--M--V--L--Q--Q--A--A--I--P--I--Q--I--N--V--G--T--T--V--T--M--T-
GCATGTGGTCCGGCCTATGTCTCACTACACCACCCCCATGGTGCTCCAGCAGGCAGCCATTCCCATACAGATCAATGTGGGAACCACTGTGACCATGACA
:::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::.::::: ::::::::.:::::.:::::::::::::::::.
GCATGTGGTCCGGCCCATGTCTCACTACACCACCCCCATGGTGCTCCAGCAGGCAGCCATCCCCATCCAGATCAACGTGGGGACCACTGTGACCATGACG
--H--V--V--R--P--M--S--H--Y--T--T--P--M--V--L--Q--Q--A--A--I--P--I--Q--I--N--V--G--T--T--V--T--M--T-

----------------------------------------------------------------------------------------------------
-G--N--G--T--R--P--P--P--T--P--N--A--E--A--P--P--P--G--P--G--Q--A--S--S--V--A--P--S--S--T--N--V--E--
GGAAATGGGACTCGGCCCCCCCCAACTCCCAATGCAGAGGCACCTCCCCCTGGTCCTGGGCAGGCCTCATCCGTGGCTCCGTCTTCTACCAATGTCGAGT
::.:::::::::::::::::::::::::::::.::.:::::::::::::::::::::::::::::::::::: : ::::: :::::::::: .:::::::
GGGAATGGGACTCGGCCCCCCCCAACTCCCAACGCGGAGGCACCTCCCCCTGGTCCTGGGCAGGCCTCATCCCTTGCTCCCTCTTCTACCACCGTCGAGT
-G--N--G--T--R--P--P--P--T--P--N--A--E--A--P--P--P--G--P--G--Q--A--S--S--L--A--P--S--S--T--T--V--E--

----------------------------------------------------------------------------------------------------
S--S--A--E--G--A--P--P--P--G--P--A--P--P--P--A--T--S--H--P--R--V--I--R--I--S--H--Q--S--V--E--P--V--V
CCTCAGCTGAGGGGGCTCCCCCGCCAGGTCCAGCTCCCCCGCCAGCCACCAGCCACCCGAGGGTCATCCGGATTTCCCACCAGAGTGTGGAACCCGTGGT
:.:::.::::::::::::::::.::::: ::.:::::::: ::.:::.:::::::::::::::::::::::::::::::::::::.::::::::::::::
CTTCAACTGAGGGGGCTCCCCCACCAGGGCCGGCTCCCCCCCCGGCCGCCAGCCACCCGAGGGTCATCCGGATTTCCCACCAGAGCGTGGAACCCGTGGT
S--S--T--E--G--A--P--P--P--G--P--A--P--P--P--A--A--S--H--P--R--V--I--R--I--S--H--Q--S--V--E--P--V--V

-------------------------------><-------------------------------------------------------------------
--M--M--H--M--N--I--Q--D--S--G--T--Q--P--G--G--V--P--S--A--P--T--G--P--L--G--P--P--G--H--G--Q--T--L-
CATGATGCACATGAACATTCAAGATTCTGGCACACAGCCTGGTGGTGTTCCGAGTGCTCCCACTGGCCCCCTGGGACCCCCTGGTCATGGCCAAACCCTG
.::::::::::::::::: :::   ::::::::::::::.::::: ::::::::.::.::::::::::::::.:::::: :::::::::::::.::::::
TATGATGCACATGAACATACAA---TCTGGCACACAGCCCGGTGGAGTTCCGAGCGCCCCCACTGGCCCCCTAGGACCCACTGGTCATGGCCAGACCCTG
--M--M--H--M--N--I--Q-----S--G--T--Q--P--G--G--V--P--S--A--P--T--G--P--L--G--P--T--G--H--G--Q--T--L-

---------><-----------------------------------------------------------------------------------------
-G--Q--Q--V--P--G--F--P--T--A--P--T--R--V--V--I--A--R--P--T--P--P--Q--A--R--P--S--H--P--G--G--P--P--
GGACAGCAGGTGCCAGGCTTCCCAACAGCTCCAACCCGGGTGGTGATTGCCCGGCCCACTCCTCCACAGGCTCGGCCTTCCCATCCTGGAGGGCCCCCAG
   ::::::::::::::::::::.::::::::.::::::::::::::::::::::::::.:::::.::: :::::::::::::::::::.::::::::::
---CAGCAGGTGCCAGGCTTCCCGACAGCTCCGACCCGGGTGGTGATTGCCCGGCCCACCCCTCCGCAGTCTCGGCCTTCCCATCCTGGGGGGCCCCCAG
----Q--Q--V--P--G--F--P--T--A--P--T--R--V--V--I--A--R--P--T--P--P--Q--S--R--P--S--H--P--G--G--P--P--

----------------------><----------------------------------------------------------------------------
V--S--G--T--L--Q--G--A--G--L--G--T--N--A--S--L--A--Q--M--V--S--G--L--V--G--Q--L--L--M--Q--P--V--L--V
TCTCTGGGACACTGCAGGGCGCCGGTCTGGGTACCAATGCCTCGTTGGCCCAGATGGTGAGCGGCCTTGTGGGGCAGCTTCTTATGCAGCCAGTCCTTGT
:::: :::.: :::                        ::::: ::.::::::::::::::::::::.::::::::::::::.:::::::: :: :::::
TCTCGGGGGCTCTG------------------------GCCTCTTTAGCCCAGATGGTGAGCGGCCTCGTGGGGCAGCTTCTCATGCAGCCTGTGCTTGT
V--S--G--A--L--------------------------A--S--L--A--Q--M--V--S--G--L--V--G--Q--L--L--M--Q--P--V--L--V

----------><----------------------------------------------------------------------------------------
--A--Q--G--T--P--G--M--A--P--P--P--A--P--A--T--A--S--A--S--A--G--T--T--N--T--A--T--T--A--G--P--A--P-
GGCTCAGGGGACCCCAGGTATGGCTCCACCGCCAGCCCCTGCCACTGCTTCTGCCAGTGCTGGCACCACCAACACAGCTACCACAGCTGGCCCCGCTCCT
:   :::::::::::::: ::::::::.:: ::::::::::::::.:: :: ::::::::.:::::::::::::::::.::::::::::::::.::.::.
G---CAGGGGACCCCAGGAATGGCTCCGCCTCCAGCCCCTGCCACCGCGTCAGCCAGTGCCGGCACCACCAACACAGCCACCACAGCTGGCCCTGCCCCC
-----Q--G--T--P--G--M--A--P--P--P--A--P--A--T--A--S--A--S--A--G--T--T--N--T--A--T--T--A--G--P--A--P-

----------------------------------------------------------------------------------------------------
-G--G--P--A--Q--P--P--P--T--P--Q--P--S--M--A--D--L--Q--F--S--Q--L--L--G--N--L--L--G--P--A--G--P--G--
GGGGGGCCTGCCCAGCCTCCACCCACCCCTCAACCCTCCATGGCTGATCTTCAGTTCTCTCAGCTTCTGGGGAACCTGCTAGGGCCTGCAGGGCCAGGGG
:::::::: :::::::::::.:::   :::::.:::::...  ::::::::::::::::::::::.::::: ::::::::.::::::::::::::.::::
GGGGGGCCGGCCCAGCCTCCGCCC---CCTCAGCCCTCTGCCTCTGATCTTCAGTTCTCTCAGCTCCTGGGCAACCTGCTGGGGCCTGCAGGGCCGGGGG
-G--G--P--A--Q--P--P--P-----P--Q--P--S--A--S--D--L--Q--F--S--Q--L--L--G--N--L--L--G--P--A--G--P--G--

-------------------------------------------------------------------------------------------------><-
A--G--G--S--G--V--A--S--P--T--I--T--V--A--M--P--G--V--P--A--F--L--Q--G--M--T--D--F--L--Q--A--T--Q--T
CTGGAGGGTCTGGTGTGGCTTCTCCCACCATCACTGTGGCGATGCCTGGTGTCCCTGCCTTTCTCCAAGGCATGACTGACTTCTTGCAGGCAACACAGAC
::::::: .::::..::.::::::::::::::::.::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::: ::.::
CTGGAGGCCCTGGCATGACTTCTCCCACCATCACCGTGGCGATGCCTGGTGTCCCTGCCTTTCTCCAGGGCATGACTGACTTCTTGCAGGCAACCCAAAC
A--G--G--P--G--M--T--S--P--T--I--T--V--A--M--P--G--V--P--A--F--L--Q--G--M--T--D--F--L--Q--A--T--Q--T

----------------------------------------------------------------------------------------------------
--A--P--P--P--------P--P--P--P--P--P--P--P--P--A--P--E--Q--Q--T--M--P--P--P--G--S--P--S--G--G--A--G-
AGCCCCTCCACCA------CCCCCACCTCCTCCACCCCCACCACCTGCCCCAGAGCAGCAGACCATGCCCCCACCAGGCTCCCCTTCTGGTGGCGCAGGG
.::: :::::::       :: :: :: ::.::.:::::::: :: ::::::::.:::::::: ...::.:::::::: ::::::.::::::::::::::
GGCCGCTCCACCCGCTCCGCCACCTCCACCCCCGCCCCCACCTCCAGCCCCAGAACAGCAGACGGCACCTCCACCAGGGTCCCCTCCTGGTGGCGCAGGG
--A--A--P--P--A--P--P--P--P--P--P--P--P--P--P--A--P--E--Q--Q--T--A--P--P--P--G--S--P--P--G--G--A--G-

----------------------------------------------------------------------------------------------------
-S--P--G--G--L--G--L--E--S--L--S--P--E--F--F--T--S--V--V--Q--G--V--L--S--S--L--L--G--S--L--G--A--R--
AGTCCTGGAGGCCTGGGTCTTGAGAGCCTGTCACCGGAGTTTTTTACCTCAGTGGTGCAGGGTGTGCTCAGCTCCCTGCTGGGCTCCCTGGGGGCTCGGG
:::::.:: ::::::::::. :::::::::.:.:.:::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::
AGTCCCGGTGGCCTGGGTCCGGAGAGCCTGCCGCTGGAGTTTTTTACCTCGGTGGTGCAGGGTGTGCTCAGCTCCCTGCTGGGCTCCCTGGGGGCTCGGG
-S--P--G--G--L--G--P--E--S--L--P--L--E--F--F--T--S--V--V--Q--G--V--L--S--S--L--L--G--S--L--G--A--R--

-----------------------------------------------------------------------------------------------><---
A--G--S--S--E--S--I--A--A--F--I--Q--R--L--S--G--S--S--N--I--F--E--P--G--A--D--G--A--L--G--F--F--G--A
CTGGCAGCAGTGAAAGTATTGCTGCCTTCATACAACGCCTCAGTGGATCCAGCAACATCTTTGAGCCTGGAGCTGATGGGGCCCTTGGATTCTTTGGGGC
:::::::::::::.:::::.:::::.::::::::::::::.::::::::::::::::::::.::::::::.::::::::::::      :::::::::::
CTGGCAGCAGTGAGAGTATCGCTGCTTTCATACAACGCCTTAGTGGATCCAGCAACATCTTCGAGCCTGGGGCTGATGGGGCC------TTCTTTGGGGC
A--G--S--S--E--S--I--A--A--F--I--Q--R--L--S--G--S--S--N--I--F--E--P--G--A--D--G--A--------F--F--G--A

----------------------------------------------------------------------------------------------------
--L--L--S--L--L--C--Q--N--F--S--M--V--D--V--V--M--L--L--H--G--H--F--Q--P--L--Q--R--L--Q--P--Q--L--R-
CTTGCTTTCTCTTCTGTGCCAGAACTTCTCTATGGTGGACGTAGTGATGCTTCTCCATGGGCATTTCCAGCCACTACAACGGCTCCAGCCCCAGCTGCGA
:.::::.::::::::::::::::::::.::.:::::::::::.::::::::::::::::::::::::::::::::.::.:::::::::::::::::::::
CCTGCTCTCTCTTCTGTGCCAGAACTTTTCCATGGTGGACGTGGTGATGCTTCTCCATGGGCATTTCCAGCCACTGCAGCGGCTCCAGCCCCAGCTGCGA
--L--L--S--L--L--C--Q--N--F--S--M--V--D--V--V--M--L--L--H--G--H--F--Q--P--L--Q--R--L--Q--P--Q--L--R-

-----------------------------------------------------------------><---------------------------------
-S--F--F--H--Q--H--Y--L--G--G--Q--E--P--T--P--S--N--I--R--M--A--T--H--T--L--I--T--G--L--E--E--Y--V--
TCCTTCTTCCACCAGCACTACCTGGGTGGTCAGGAGCCCACACCCAGTAACATCCGGATGGCAACCCACACATTGATCACGGGGCTAGAAGAGTATGTGC
::::::::::::::::::::::::::.::.::::::::::::::..:::::::::::                                           
TCCTTCTTCCACCAGCACTACCTGGGCGGCCAGGAGCCCACACCTGGTAACATCCGG-------------------------------------------
-S--F--F--H--Q--H--Y--L--G--G--Q--E--P--T--P--G--N--I--R--------------------------------------------

-------------------><-------------------------------------------------------------------------------
R--E--S--F--S--L--V--Q--V--Q--P--G--V--D--I--I--R--T--N--L--E--F--L--Q--E--Q--F--N--S--I--A--A--H--V
GGGAGAGTTTTTCCTTGGTGCAGGTTCAGCCAGGTGTGGACATCATCCGGACAAACCTGGAATTTCTCCAAGAGCAGTTTAATAGCATTGCTGCGCATGT
           ::.::::::::.:::::::::::::::::.::::::::.::::::::::::::::::::::::::.::::::::::::::::: ::.::
-----------TCTTTGGTGCAAGTTCAGCCAGGTGTGGATATCATCCGAACAAACCTGGAATTTCTCCAAGAGCAATTTAATAGCATTGCTGCTCACGT
------------S--L--V--Q--V--Q--P--G--V--D--I--I--R--T--N--L--E--F--L--Q--E--Q--F--N--S--I--A--A--H--V

----------------------><----------------------------------------------------------------------------
--L--H--C--T--D--S--G--F--G--A--R--L--L--E--L--C--N--Q--G--L--F--E--C--L--A--L--N--L--H--C--L--G--G-
GCTGCATTGCACAGATAGTGGATTTGGGGCCCGGTTGCTGGAGTTGTGTAACCAAGGCCTGTTTGAATGCCTGGCCCTAAACCTGCACTGCTTGGGGGGA
: ::::.::::::   :::::.::::::::::: ::::::::::::::::::::.::::::::: .:::::::::.::.:::::::::::::::::::::
GATGCACTGCACA---AGTGGGTTTGGGGCCCGTTTGCTGGAGTTGTGTAACCAGGGCCTGTTTTGATGCCTGGCTCTGAACCTGCACTGCTTGGGGGGA
--M--H--C--T-----S--G--F--G--A--R--L--L--E--L--C--N--Q--G--L--F--*--C--L--A--L--N--L--H--C--L--G--G-

-----------------------------------------------><---------------------------------------------------
-Q--Q--M--E--L--A--A--V--I--N--G--R--I--R--R--M--S--R--G--V--N--P--S--L--V--S--W--L--T--T--M--M--G--
CAGCAGATGGAGCTTGCTGCTGTTATCAATGGCCGAATTCGTCGTATGTCTCGTGGGGTGAATCCCTCCTTGGTGAGCTGGCTGACCACTATGATGGGAC
::::::::::::::.:::::::::::::::::::::::::::::.:::::::::::.:::::::: ::::::::::::::::::::::::::::::::.:
CAGCAGATGGAGCTCGCTGCTGTTATCAATGGCCGAATTCGTCGCATGTCTCGTGGAGTGAATCCGTCCTTGGTGAGCTGGCTGACCACTATGATGGGGC
-Q--Q--M--E--L--A--A--V--I--N--G--R--I--R--R--M--S--R--G--V--N--P--S--L--V--S--W--L--T--T--M--M--G--

----------------------------------------------------------------------------------------------><----
L--R--L--Q--V--V--L--E--H--M--P--V--G--P--D--A--I--L--R--Y--V--R--R--V--G--D--P--P--Q--P--L--P--E--E
TGAGGCTTCAGGTGGTACTGGAGCACATGCCTGTAGGCCCTGATGCCATTCTCAGATACGTTCGCAGGGTTGGTGATCCCCCCCAGCCACTTCCTGAGGA
::::::::::::::::::::::::::::::::::::: ::.::::::::.:::::::::::.::::::::::::::::::::::::::::::::::::::
TGAGGCTTCAGGTGGTACTGGAGCACATGCCTGTAGGGCCCGATGCCATCCTCAGATACGTCCGCAGGGTTGGTGATCCCCCCCAGCCACTTCCTGAGGA
L--R--L--Q--V--V--L--E--H--M--P--V--G--P--D--A--I--L--R--Y--V--R--R--V--G--D--P--P--Q--P--L--P--E--E

------------------------------------------------------><--------------------------------------------
--P--M--E--V--Q--G--A--E--R--A--S--P--E--P--Q--R--E--N--A--S--P--A--P--G--T--T--A--E--E--A--M--S--R-
GCCAATGGAAGTTCAGGGAGCAGAAAGAGCTTCCCCTGAGCCTCAGCGGGAGAATGCTTCCCCAGCCCCTGGAACAACAGCAGAAGAGGCCATGTCCCGA
:::::::::::: :::::: ::::.:::.:::::::::::::::::::::::::.::::::::::::::.::::::::::::::::::::::::::::::
GCCAATGGAAGTGCAGGGATCAGAGAGAACTTCCCCTGAGCCTCAGCGGGAGAACGCTTCCCCAGCCCCCGGAACAACAGCAGAAGAGGCCATGTCCCGA
--P--M--E--V--Q--G--S--E--R--T--S--P--E--P--Q--R--E--N--A--S--P--A--P--G--T--T--A--E--E--A--M--S--R-

--------------------------------------------------------------------------------------------------><
-G--P--P--P--A--P--E--G--G--S--R--D--E--Q--D--G--A--S--A--E--T--E--P--W--A--A--A--V--P--P--E--W--V--
GGTCCACCTCCTGCTCCTGAGGGGGGCTCCCGGGATGAACAGGATGGAGCTTCAGCTGAGACAGAACCTTGGGCAGCTGCAGTCCCCCCAGAATGGGTCC
::::::::::::::::::::::::::::::::.::.::::::::::::::: ::::.:::::::::::::::::.:::::::::::::::::::::::::
GGTCCACCTCCTGCTCCTGAGGGGGGCTCCCGAGACGAACAGGATGGAGCTGCAGCCGAGACAGAACCTTGGGCGGCTGCAGTCCCCCCAGAATGGGTCC
-G--P--P--P--A--P--E--G--G--S--R--D--E--Q--D--G--A--A--A--E--T--E--P--W--A--A--A--V--P--P--E--W--V--

----------------------------------------------------------------------------------------------------
P--I--I--Q--Q--D--I--Q--S--Q--R--K--V--K--P--Q--P--P--L--S--D--A--Y--L--S--G--M--P--A--K--R--R--K--T
CTATTATCCAGCAGGACATTCAGAGCCAGCGGAAGGTGAAACCGCAGCCCCCTCTGAGTGATGCCTACCTCAGTGGTATGCCTGCCAAGAGACGCAAGAC
::::::::::::::::::::::::::::::::::::::::::::::::::::.::.::.:::::::::::::::::::::::::::::::::::::::::
CTATTATCCAGCAGGACATTCAGAGCCAGCGGAAGGTGAAACCGCAGCCCCCCCTAAGCGATGCCTACCTCAGTGGTATGCCTGCCAAGAGACGCAAGAC
P--I--I--Q--Q--D--I--Q--S--Q--R--K--V--K--P--Q--P--P--L--S--D--A--Y--L--S--G--M--P--A--K--R--R--K--T

------><--------------------------------------------------------------------------------------------
--M--Q--G--E--G--P--Q--L--L--L--S--E--A--V--S--R--A--A--K--A--A--G--A--R--P--L--T--S--P--E--S--L--S-
GATGCAGGGTGAGGGCCCCCAGCTGCTTCTCTCAGAGGCTGTGAGCCGGGCAGCTAAGGCAGCCGGAGCTCGGCCCCTGACGAGCCCCGAGAGCCTGAGC
:::::::::::::::::::::::::::::::::::::::.:::::::: :::::::::::::::::::::::::::::::::::::::::::::::::::
GATGCAGGGTGAGGGCCCCCAGCTGCTTCTCTCAGAGGCCGTGAGCCGTGCAGCTAAGGCAGCCGGAGCTCGGCCCCTGACGAGCCCCGAGAGCCTGAGC
--M--Q--G--E--G--P--Q--L--L--L--S--E--A--V--S--R--A--A--K--A--A--G--A--R--P--L--T--S--P--E--S--L--S-

-----------------------------------------------------><---------------------------------------------
-R--D--L--E--A--P--E--V--Q--E--S--Y--R--Q--Q--L--R--S--D--I--Q--K--R--L--Q--E--D--P--N--Y--S--P--Q--
CGGGACCTGGAGGCACCAGAGGTTCAGGAGAGCTACAGGCAGCAGCTCCGGTCTGATATACAAAAACGACTGCAGGAAGACCCCAACTACAGTCCCCAGC
::::::::::::::::::::::::::::::::::::::::::::::::::. :::::::::::::.::::::::::::::::::::::::::::::::::
CGGGACCTGGAGGCACCAGAGGTTCAGGAGAGCTACAGGCAGCAGCTCCGAGCTGATATACAAAAGCGACTGCAGGAAGACCCCAACTACAGTCCCCAGC
-R--D--L--E--A--P--E--V--Q--E--S--Y--R--Q--Q--L--R--A--D--I--Q--K--R--L--Q--E--D--P--N--Y--S--P--Q--

-----------------------------------------
R--F--P--N--A--Q--R--A--F--A--D--D--P--*-
GCTTCCCCAATGCCCAGCGGGCCTTTGCTGATGATCCTTAG
:::::::.::::::::  ::::::::::::: :::::.:::
GCTTCCCTAATGCCCACAGGGCCTTTGCTGAAGATCCCTAG
R--F--P--N--A--H--R--A--F--A--E--D--P--*-

Pig Consensus Sequence

>BGISUST0000889067
ATGGAGCCCAATGATAGTACCAGTACCACTATGGAAGAGCCTGAAAGCCTGGAGGTGCTGGTGAAGACCCTGGACTCTCAGACCCGGACCTTTATTGTGG
GGGCCCAGATGAATGTAAAGGAGTTTAAGGAGCACATTGCTGCCTCTGTCAGCATCCCTTCTGAGAAACAACGGCTTATCTACCAGGGCCGTGTTCTGCA
GGATGATAAGAAGCTCCAGGAATAC---GTTGGAGGAAAAGTTATCCACCTTGTGGAACGGGCTCCTCCTCAGACTCAGCTCCCTTCAGGGGCATCTTCT
GGAACAGGGTCTGCCTCAGCCACCCATGGTGGGGGACCCCCACCTGGTACTCGGGGGCCTGGGGCCTCCGTGCATGACCGGAATGCCAACAGCTATGTCA
TGGTTGGAACCTTCAATCTT---AGTGACGGCTCTGCTGTGGATGTTCACATCAACATGGAACAGGCCCCGATTCAGAGTGAGCCCCGAGTCCGGCTGGT
GATGGCTCAGCACATGATCAGGGACATACAGACCTTACTGTCCCGGATGGAGTCTCATCCTGTCTTGGGTGTCCTTGTCCTGACttCCCCTGACCTTCAG
TGCCGCGGGGGGTCCCAAGCACAGCACAGTCAGCCACCCTCGCAGATGCCAACTGTCGCCCCGGAGCCGGTAGCCTTGAGCTCTCAAACATCAGAATCCG
TCGAAAGCGAAGTGCCTCCCCGGGAGCCCATGGCGGCAGAAGAAGTGGAGGAGCGGGCCTCTGCCCAGAGCCCGGGGCTCAGTCCTTCTGGCCCAGCCCC
AGCGGGCCCAACACCTGCGCCAGAGACA---CACCCTTCCCCTGCGGAGTACGTcgTgcAGGAGCTCCAGCGGCTTGAGAGCCGCCTCCAGCCCTTCCTG
CAGCGCTACTAtgTTCTGGGCGCCGCTGCCACCACGGACTACAACAAC---CAAGAGGCCCGCGAAGAGGACCAGCGCTTGATCAACTTGGTGGGAGAGA
GCCTGCGGCTGCTGGGCAACACCTTTGTGGCGCTGTCTGACCTGCGCTGCAACCTGGCCTGTGCGCCGCCTCGGCACCTGCATGTGGTCCGGCCCATGTC
TCACTACACCACCCCCATGGTGCTCCAGCAGGCAGCCATCCCCATCCAGATCAACGTGGGGACCACTGTGACCATGACGGGGAATGGGACTCGGCCCCCC
CCAACTCCCAACGCGGAGGCACCTCCCCCTGGTCCTGGGCAGGCCTCATCCCTTGCTCCCTCTTCTACCACCGTCGAGTCTTCAACTGAGGGGGCTCCCC
CACCAGGGCCGGCTCCCCCCCCGGCCGCCAGCCACCCGAGGGTCATCCGGATTTCCCACCAGAGCGTGGAACCCGTGGTTATGATGCACATGAACATACA
A---TCTGGCACACAGCCCGGTGGAGTTCCGAGCGCCCCCACTGGCCCCCTAGGACCCACTGGTCATGGCCAGACCCTG---CAGCAGGTGCCAGGCTTC
CCGACAGCTCCGACCCGGGTGGTGATTGCCCGGCCCACCCCTCCGCAGTCTCGGCCTTCCCATCCTGGGGGGCCCCCAGTCTCGGGGGCTCTG-------
-----------------GCCTCTTTAGCCCAGATGGTGAGCGGCCTCGTGGGGCAGCTTCTCATGCAGCCTGTGCTTGTG---CAGGGGACCCCAGGAAT
GGCTCCGCCTCCAGCCCCTGCCACCGCGTCAGCCAGTGCCGGCACCACCAACACAGCCACCACAGCTGGCCCTGCCCCCGGGGGGCCGGCCCAGCCTCCG
CCCCCTCAGCCCTCTGCCTCTGATCTTCAGTTCTCTCAGCTCCTGGGCAACCTGCTGGGGCCTGCAGGGCCGGGGGCTGGAGGCCCTGGCATGACTTCTC
CCACCATCACCGTGGCGATGCCTGGTGTCCCTGCCTTTCTCCAGGGCATGACTGACTTCTTGCAGGCAACCCAAACGGCCGCTCCACCCGCTCCGCCACC
TCCACCCCCGCCCCCACCTCCAGCCCCAGAACAGCAGACGGCACCTCCACCAGGGTCCCCTCCTGGTGGCGCAGGGAGTCCCGGTGGCCTGGGTCCGGAG
AGCCTGCCGCTGGAGTTTTTTACCTCGGTGGTGCAGGGTGTGCTCAGCTCCCTGCTGGGCTCCCTGGGGGCTCGGGCTGGCAGCAGTGAGAGTATCGCTG
CTTTCATACAACGCCTTAGTGGATCCAGCAACATCTTCGAGCCTGGGGCTGAT------TTCTTTGGGGCCCTGCTCTCTCTTCTGTGCCAGAACTTTTC
CATGGTGGACGTGGTGATGCTTCTCCATGGGCATTTCCAGCCACTGCAGCGGCTCCAGCCCCAGCTGCGATCCTTCTTCCACCAGCACTACCTGGGCGGC
CAGGAGCCCACACCTGGTAACATCCGG------------------------------------------------------TCTTTGGTGCAAGTTCAGC
CAGGTGTGGATATCATCCGAACAAACCTGGAATTTCTCCAAGAGCAATTTAATAGCATTGCTGCTCACGTGATGCACTGCACA---AGTGGGTTTGGGGC
CCGTTTGCTGGAGTTGTGTAACCAGGGCCTGTTTTGATGCCTGGCTCTGAACCTGCACTGCTTGGGGGGACAGCAGATGGAGCTCGCTGCTGTTATCAAT
GGCCGAATTCGTCGCATGTCTCGTGGAGTGAATCCGTCCTTGGTGAGCTGGCTGACCACTATGATGGGGCTGAGGCTTCAGGTGGTACTGGAGCACATGC
CTGTAGGGCCCGATGCCATCCTCAGATACGTCCGCAGGGTTGGTGATCCCCCCCAGCCACTTCCTGAGGAGCCAATGGAAGTGCAGGGATCAGAGAGAAC
TTCCCCTGAGCCTCAGCGGGAGAACGCTTCCCCAGCCCCCGGAACAACAGCAGAAGAGGCCATGTCCCGAGGTCCACCTCCTGCTCCTGAGGGGGGCTCC
CGAGACGAACAGGATGGAGCTGCAGCCGAGACAGAACCTTGGGCGGCTGCAGTCCCCCCAGAATGGGTCCCTATTATCCAGCAGGACATTCAGAGCCAGC
GGAAGGTGAAACCGCAGCCCCCCCTAAGCGATGCCTACCTCAGTGGTATGCCTGCCAAGAGACGCAAGACGATGCAGGGTGAGGGCCCCCAGCTGCTTCT
CTCAGAGGCCGTGAGCCGTGCAGCTAAGGCAGCCGGAGCTCGGCCCCTGACGAGCCCCGAGAGCCTGAGCCGGGACCTGGAGGCACCAGAGGTTCAGGAG
AGCTACAGGCAGCAGCTCCGAGCTGATATACAAAAGCGACTGCAGGAAGACCCCAACTACAGTCCCCAGCGCTTCCCTAATGCCCACAGGGCCTTTGCTG
AAGATCCCTAG


>BGISUSP0000889067
MEPNDSTSTTMEEPESLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEY-VGGKVIHLVERAPPQTQLPSGASS
GTGSASATHGGGPPPGTRGPGASVHDRNANSYVMVGTFNL-SDGSAVDVHINMEQAPIQSEPRVRLVMAQHMIRDIQTLLSRMESHPVLGVLVLTSPDLQ
CRGGSQAQHSQPPSQMPTVAPEPVALSSQTSESVESEVPPREPMAAEEVEERASAQSPGLSPSGPAPAGPTPAPET-HPSPAEYVVQELQRLESRLQPFL
QRYYVLGAAATTDYNN-QEAREEDQRLINLVGESLRLLGNTFVALSDLRCNLACAPPRHLHVVRPMSHYTTPMVLQQAAIPIQINVGTTVTMTGNGTRPP
PTPNAEAPPPGPGQASSLAPSSTTVESSTEGAPPPGPAPPPAASHPRVIRISHQSVEPVVMMHMNIQ-SGTQPGGVPSAPTGPLGPTGHGQTL-QQVPGF
PTAPTRVVIARPTPPQSRPSHPGGPPVSGAL--------ASLAQMVSGLVGQLLMQPVLV-QGTPGMAPPPAPATASASAGTTNTATTAGPAPGGPAQPP
PPQPSASDLQFSQLLGNLLGPAGPGAGGPGMTSPTITVAMPGVPAFLQGMTDFLQATQTAAPPAPPPPPPPPPPAPEQQTAPPPGSPPGGAGSPGGLGPE
SLPLEFFTSVVQGVLSSLLGSLGARAGSSESIAAFIQRLSGSSNIFEPGAD--FFGALLSLLCQNFSMVDVVMLLHGHFQPLQRLQPQLRSFFHQHYLGG
QEPTPGNIR------------------SLVQVQPGVDIIRTNLEFLQEQFNSIAAHVMHCT-SGFGARLLELCNQGLF*CLALNLHCLGGQQMELAAVIN
GRIRRMSRGVNPSLVSWLTTMMGLRLQVVLEHMPVGPDAILRYVRRVGDPPQPLPEEPMEVQGSERTSPEPQRENASPAPGTTAEEAMSRGPPPAPEGGS
RDEQDGAAAETEPWAAAVPPEWVPIIQQDIQSQRKVKPQPPLSDAYLSGMPAKRRKTMQGEGPQLLLSEAVSRAAKAAGARPLTSPESLSRDLEAPEVQE
SYRQQLRADIQKRLQEDPNYSPQRFPNAHRAFAEDP*