Sequences
EST Library Info
cga1Galactophore - RNA from China
cly2Lymph - RNA from China
eep1Foetus 50 days, epidermis
fbs1Unavailable
med3Mediastinum
nje3Newborn 115 days, jejunum
nmm1Newborn 115 days, mucosal membranes
Clusters
Oligos
SNPs

Gene ID ENSG00000096171 (click for geneview)
Transcript ID ENST00000211402(link to ensembl)
Symbol VARS2
Localtion Chromosome:6:31853280:31871489:-1 band: 6p21.33
Description Valyl-tRNA synthetase 2 (EC 6.1.1.9) (Valine--tRNA ligase 2) (ValRS 2) (G7a). [Source:Uniprot/SWISSPROT;Acc:P26640]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--S--T--L--Y--V--S--P--H--P--D--A--F--P--S--L--R--A--L--I--A--A--R--Y--G--E--A--G--E--G--P--G--W--
ATGTCCACCCTCTACGTCTCCCCTCACCCAGATGCCTTCCCCAGCCTCCGAGCCCTCATAGCCGCTCGCTATGGGGAGGCTGGGGAGGGTCCCGGATGGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
G--G--A--H--P--R--I--C--L--Q--P--P--P--T--S--R--T--P--F--P--P--P--R--L--P--A--L--E--Q--G--P--G--G--L
GAGGAGCCCACCCCCGCATCTGTCTCCAGCCACCCCCGACTAGCAGGACTCCCTTTCCCCCACCCCGCCTGCCGGCCCTGGAGCAGGGGCCCGGTGGGCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--W--V--W--G--A--T--A--V--A--Q--L--L--W--P--A--G--L--G--G--P--G--G--S--R--A--A--V--L--V--Q--Q--W--V-
CTGGGTGTGGGGGGCCACGGCTGTGGCCCAGCTGCTGTGGCCAGCAGGCCTGGGGGGCCCAGGGGGCAGCCGGGCGGCTGTCCTTGTCCAACAGTGGGTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------------------------------------------------><------------
-S--Y--A--D--T--E--L--I--P--A--A--C--G--A--T--L--P--A--L--G--L--R--S--S--A--Q--D--P--Q--A--V--L--G--
AGTTACGCCGACACGGAGTTAATACCAGCTGCCTGTGGAGCAACGCTGCCGGCCCTGGGACTCCGAAGCTCGGCCCAGGACCCCCAGGCTGTGCTGGGGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
A--L--G--R--A--L--S--P--L--E--E--W--L--R--L--H--T--Y--L--A--G--E--A--P--T--L--A--D--L--A--A--V--T--A
CCCTGGGCAGGGCCCTGAGCCCCTTGGAGGAGTGGCTTCGGCTGCACACCTACTTGGCCGGGGAGGCCCCCACTCTGGCTGACCTGGCGGCTGTCACAGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------><-----------------------------------------------------------------------------
--L--L--L--P--F--R--Y--V--L--D--P--P--A--R--R--I--W--N--N--V--T--R--W--F--V--T--C--V--R--Q--P--E--F-
CTTGCTGCTGCCTTTCCGATACGTCCTAGACCCACCTGCCCGCCGGATCTGGAATAATGTGACTCGCTGGTTTGTCACGTGTGTCCGGCAGCCAGAATTC
                      :::::.::.:: .::::::: :::::::::...::::::::.:::::::::.:::: :::::::.:::::::::::::
----------------------GTCCTGGATCCCTCTGCCCGGCGGATCTGGGGCAATGTGACCCGCTGGTTTATCACCTGTGTCCAGCAGCCAGAATTC
-----------------------V--L--D--P--S--A--R--R--I--W--G--N--V--T--R--W--F--I--T--C--V--Q--Q--P--E--F-

------------------------------------------------------------><--------------------------------------
-R--A--V--L--G--E--V--V--L--Y--S--G--A--R--P--L--S--H--Q--P--G--P--E--A--P--A--L--P--K--T--A--A--Q--
CGAGCCGTGCTAGGAGAAGTGGTTCTATACTCAGGAGCCAGGCCTCTCTCTCATCAGCCAGGCCCCGAGGCTCCTGCCCTCCCAAAGACAGCTGCTCAGC
::.::::::::::::::.::::::::.: ::::::..:::::::: .:::.:: ::::::   :::::::...:::: :.: ::::::::::.:::::.:
CGGGCCGTGCTAGGAGAGGTGGTTCTGTTCTCAGGGACCAGGCCTGCCTCCCAACAGCCA---CCCGAGGTCTCTGCACCCACAAAGACAGCCGCTCAAC
-R--A--V--L--G--E--V--V--L--F--S--G--T--R--P--A--S--Q--Q--P-----P--E--V--S--A--P--T--K--T--A--A--Q--

-------------------------------------------------------------------------------------><-------------
L--K--K--E--A--K--K--R--E--K--L--E--K--F--Q--Q--K--Q--K--I--Q--Q--Q--Q--P--P--P--G--E--K--K--P--K--P
TCAAGAAAGAGGCAAAGAAACGGGAGAAGCTAGAGAAATTCCAACAGAAGCAGAAGATCCAACAGCAGCAGCCACCTCCAGGGGAGAAGAAACCAAAACC
::::::::::::::::.::.:::::::::.:::::::::::::::::::.:::::::::::.::::::::::::::.:: ::::::::::::::::::::
TCAAGAAAGAGGCAAAAAAGCGGGAGAAGTTAGAGAAATTCCAACAGAAACAGAAGATCCAGCAGCAGCAGCCACCCCCTGGGGAGAAGAAACCAAAACC
L--K--K--E--A--K--K--R--E--K--L--E--K--F--Q--Q--K--Q--K--I--Q--Q--Q--Q--P--P--P--G--E--K--K--P--K--P

----------------------------------------------------------------------><----------------------------
--E--K--R--E--K--R--D--P--G--V--I--T--Y--D--L--P--T--P--P--G--E--K--K--D--V--S--G--P--M--P--D--S--Y-
AGAGAAGAGGGAGAAACGGGATCCTGGGGTCATTACCTATGACCTCCCAACCCCACCCGGGGAAAAGAAAGATGTCAGTGGCCCCATGCCCGACTCCTAC
:::::::::::::::::::::::::::::::::::::::::::::::::::::: ::.:::::.::::::   ::::::::: : :::::::::::::::
AGAGAAGAGGGAGAAACGGGATCCTGGGGTCATTACCTATGACCTCCCAACCCCCCCTGGGGAGAAGAAA---GTCAGTGGCACGATGCCCGACTCCTAC
--E--K--R--E--K--R--D--P--G--V--I--T--Y--D--L--P--T--P--P--G--E--K--K-----V--S--G--T--M--P--D--S--Y-

-----------------------------------------------------------------------><---------------------------
-S--P--R--Y--V--E--A--A--W--Y--P--W--W--E--Q--Q--G--F--F--K--P--E--Y--G--R--P--N--V--S--A--A--N--P--
AGCCCTCGGTATGTGGAGGCTGCCTGGTACCCTTGGTGGGAGCAGCAGGGCTTCTTCAAGCCAGAGTATGGGCGTCCTAATGTGTCAGCAGCAAATCCCC
:::::::.:::.:: ::::::::::::::::::::::::::::.:::::::::::::::::: ::::::::::::.:.:..::::: ::  : ::.::::
AGCCCTCAGTACGTCGAGGCTGCCTGGTACCCTTGGTGGGAGCGGCAGGGCTTCTTCAAGCCCGAGTATGGGCGTTCCAGCGTGTCTGCCCCCAACCCCC
-S--P--Q--Y--V--E--A--A--W--Y--P--W--W--E--R--Q--G--F--F--K--P--E--Y--G--R--S--S--V--S--A--P--N--P--

----------------------------------------------------------------------------------------------------
R--G--V--F--M--M--C--I--P--P--P--N--V--T--G--S--L--H--L--G--H--A--L--T--N--A--I--Q--D--S--L--T--R--W
GAGGTGTCTTCATGATGTGCATCCCACCCCCCAATGTGACAGGCTCCCTGCACCTGGGCCATGCACTCACCAACGCCATCCAGGACTCCCTGACTCGATG
:.::...::::::::::::::::::.::::::::.::::::::::::::::::::::::::.::.:::::::  ::::::::::::::::::::.:::  
GGGGCACCTTCATGATGTGCATCCCGCCCCCCAACGTGACAGGCTCCCTGCACCTGGGCCACGCGCTCACCAC-GCCATCCAGGACTCCCTGACCCGA--
R--G--T--F--M--M--C--I--P--P--P--N--V--T--G--S--L--H--L--G--H--A--L--T--N--A--I--Q--D--S--L--T--R---

--><------------------------------------------------------------------------------------------------
--H--R--M--R--G--E--T--T--L--W--N--P--G--C--D--H--A--G--I--A--T--Q--V--V--V--E--K--K--L--W--R--E--Q-
GCACCGCATGCGTGGGGAGACCACCCTGTGGAACCCTGGCTGTGACCATGCAGGTATTGCCACCCAGGTGGTGGTGGAGAAGAAGCTATGGCGTGAGCAG
 :::::::::::.:: :::::::::::::::::::: :::::.::::::::.::.                                             
-CACCGCATGCGCGGCGAGACCACCCTGTGGAACCCAGGCTGCGACCATGCGGGC---------------------------------------------
--H--R--M--R--G--E--T--T--L--W--N--P--G--C--D--H--A--G----------------------------------------------

-------------------------------------------------------------------><-------------------------------
-G--L--S--R--H--Q--L--G--R--E--A--F--L--Q--E--V--W--K--W--K--E--E--K--G--D--R--I--Y--H--Q--L--K--K--
GGACTGAGCCGGCACCAGCTGGGCCGCGAGGCCTTTCTACAGGAAGTCTGGAAGTGGAAGGAGGAGAAAGGTGACCGGATTTACCACCAGTTGAAGAAGC
                                                                  ::::::::::::::::::::::::.:::::::::
------------------------------------------------------------------AAAGGTGACCGGATTTACCACCAGCTGAAGAAGC
-------------------------------------------------------------------K--G--D--R--I--Y--H--Q--L--K--K--

-------------------------------------------------><-------------------------------------------------
L--G--S--S--L--D--W--D--R--A--C--F--T--M--D--P--K--L--S--A--A--V--T--E--A--F--V--R--L--H--E--E--G--I
TTGGCAGCTCCTTGGACTGGGATCGAGCCTGTTTCACCATGGACCCTAAACTCTCAGCAGCTGTGACAGAGGCCTTTGTCCGGCTTCACGAGGAAGGCAT
:.:::::::::::::::::::::::.:::::::::::::::::.   ::::: ::::::.:.::::. ::::::::.::::::::.::::::::::::.:
TCGGCAGCTCCTTGGACTGGGATCGGGCCTGTTTCACCATGGAT---AAACTGTCAGCAACCGTGATCGAGGCCTTCGTCCGGCTCCACGAGGAAGGCGT
L--G--S--S--L--D--W--D--R--A--C--F--T--M--D-----K--L--S--A--T--V--I--E--A--F--V--R--L--H--E--E--G--V

---------------------------------------------------------------------><-----------------------------
--I--Y--R--S--T--R--L--V--N--W--S--C--T--L--N--S--A--I--S--D--I--E--V--D--K--K--E--L--T--G--R--T--L-
CATCTATCGCAGTACCCGCCTTGTTAACTGGTCCTGCACCCTCAACTCCGCCATCTCTGACATTGAGGTGGATAAGAAGGAGCTGACAGGTCGCACCCTG
::::::.:::::::::::::::::.:::::::::::::::::::::::.:::::::: :::::.:::::::::::::::::::::::.::.::::: .::
CATCTACCGCAGTACCCGCCTTGTCAACTGGTCCTGCACCCTCAACTCTGCCATCTCGGACATCGAGGTGGATAAGAAGGAGCTGACGGGCCGCACGTTG
--I--Y--R--S--T--R--L--V--N--W--S--C--T--L--N--S--A--I--S--D--I--E--V--D--K--K--E--L--T--G--R--T--L-

------------------------------------------------------------------------------><--------------------
-L--S--V--P--G--Y--K--E--K--V--E--F--G--V--L--V--S--F--A--Y--K--V--Q--G--S--D--S--D--E--E--V--V--V--
CTCTCCGTGCCTGGCTACAAGGAGAAGGTGGAGTTCGGGGTCCTCGTGTCCTTTGCCTATAAGGTCCAAGGCTCAGATAGCGACGAGGAGGTGGTGGTGG
:: :::::::::::.::::::::::::::::::::.::::::::::: :::::::::::.:::::::::::::::   ::::::::::::::::::::::
CTGTCCGTGCCTGGTTACAAGGAGAAGGTGGAGTTTGGGGTCCTCGTCTCCTTTGCCTACAAGGTCCAAGGCTCA---AGCGACGAGGAGGTGGTGGTGG
-L--S--V--P--G--Y--K--E--K--V--E--F--G--V--L--V--S--F--A--Y--K--V--Q--G--S-----S--D--E--E--V--V--V--

-------------------------------------------------------------------------><-------------------------
A--T--T--R--I--E--T--M--L--G--D--V--A--V--A--V--H--P--K--D--T--R--Y--Q--H--L--K--G--K--N--V--I--H--P
CAACAACTCGGATCGAGACAATGCTGGGAGATGTGGCTGTAGCTGTGCACCCCAAAGATACCAGATACCAGCACCTGAAGGGGAAGAACGTGATCCACCC
::::::::::::::::::: :::::::::::.::::::.::::::::::::::.::::. :::::::::::::::::::::::::::.::::.:::::::
CAACAACTCGGATCGAGACCATGCTGGGAGACGTGGCTATAGCTGTGCACCCCGAAGACCCCAGATACCAGCACCTGAAGGGGAAGAGCGTGGTCCACCC
A--T--T--R--I--E--T--M--L--G--D--V--A--I--A--V--H--P--E--D--P--R--Y--Q--H--L--K--G--K--S--V--V--H--P

----------------------------------------------------------------><----------------------------------
--F--L--S--R--S--L--P--I--V--F--D--E--F--V--D--M--D--F--G--T--G--A--V--K--I--T--P--A--H--D--Q--N--D-
ATTCCTGTCTCGGAGCCTTCCCATTGTCTTCGATGAATTTGTGGACATGGACTTTGGCACAGGTGCTGTGAAGATCACCCCCGCACATGACCAAAATGAC
:::: ::::.::::::::.:::.:..:::::::::: :::::::::::::: :::::::::   :: : ::::::::::::::::::.:::::.::.:::
ATTCGTGTCCCGGAGCCTCCCCGTCATCTTCGATGATTTTGTGGACATGGAGTTTGGCACA---GCGGGGAAGATCACCCCCGCACACGACCAGAACGAC
--F--V--S--R--S--L--P--V--I--F--D--D--F--V--D--M--E--F--G--T-----A--G--K--I--T--P--A--H--D--Q--N--D-

-----------------------------------------------------------------------------------------><---------
-Y--E--V--G--Q--R--H--G--L--E--A--I--S--I--M--D--S--R--G--A--L--I--N--V--P--P--P--F--L--G--L--P--R--
TATGAAGTTGGGCAGCGGCACGGGCTGGAGGCCATCAGCATCATGGACTCCCGGGGGGCCCTCATCAATGTGCCTCCGCCTTTCCTGGGCCTGCCCAGGT
::.::.:::::::::::::::::::::::::::.:::::::::::::: : ::.::::::::..::::.:::::.::.:::::::::         ::::
TACGAGGTTGGGCAGCGGCACGGGCTGGAGGCCGTCAGCATCATGGACGCGCGAGGGGCCCTTGTCAACGTGCCCCCACCTTTCCTG---------AGGT
-Y--E--V--G--Q--R--H--G--L--E--A--V--S--I--M--D--A--R--G--A--L--V--N--V--P--P--P--F--L-----------R--

---------------------------------------------------------------------------------------------><-----
F--E--A--R--K--A--V--L--V--A--L--K--E--R--G--L--F--R--G--I--E--D--N--P--M--V--V--P--L--C--N--R--S--K
TTGAGGCCAGGAAAGCGGTGCTGGTGGCGCTGAAGGAGCGGGGACTGTTCCGTGGCATTGAGGACAACCCCATGGTGGTGCCACTTTGCAACCGGTCGAA
:.::::::::.::.::::::::::.::::::.:::::::::::::: :::::.:::.:::::::::::::::::::::::::.::::::   :: :: ::
TCGAGGCCAGAAAGGCGGTGCTGGCGGCGCTAAAGGAGCGGGGACTCTTCCGCGGCGTTGAGGACAACCCCATGGTGGTGCCGCTTTGC---CGTTCCAA
F--E--A--R--K--A--V--L--A--A--L--K--E--R--G--L--F--R--G--V--E--D--N--P--M--V--V--P--L--C-----R--S--K

----------------------------------------------------------------------------------------------------
--D--V--V--E--P--L--L--R--P--Q--W--Y--V--R--C--G--E--M--A--Q--A--A--S--A--A--V--T--R--G--D--L--R--I-
GGACGTGGTAGAGCCTCTGCTGCGGCCGCAGTGGTACGTTCGCTGCGGGGAGATGGCCCAGGCTGCCAGCGCCGCTGTGACTCGGGGTGACCTCCGCATC
:::::::::.::::: ::::::::::: ::::::::::: :::::.:::::::::::::::::.:::::.::.::.::::: :::::.::::::::::::
GGACGTGGTGGAGCCGCTGCTGCGGCCCCAGTGGTACGTGCGCTGTGGGGAGATGGCCCAGGCCGCCAGTGCTGCCGTGACGCGGGGCGACCTCCGCATC
--D--V--V--E--P--L--L--R--P--Q--W--Y--V--R--C--G--E--M--A--Q--A--A--S--A--A--V--T--R--G--D--L--R--I-

----------------------------------------------------><----------------------------------------------
-L--P--E--A--H--Q--R--T--W--H--A--W--M--D--N--I--R--E--W--C--I--S--R--Q--L--W--W--G--H--R--I--P--A--
CTGCCTGAGGCCCATCAGCGCACATGGCATGCCTGGATGGACAACATCCGGGAGTGGTGCATTTCCAGGCAGCTGTGGTGGGGCCATCGCATCCCAGCCT
::::: ::.:::::.::::: ::.::::::::::::::::::::::::   :: ::::::::.::: :::::::::::::::::::.::::::::.::::
CTGCCGGAAGCCCACCAGCGGACGTGGCATGCCTGGATGGACAACATC---GACTGGTGCATCTCCCGGCAGCTGTGGTGGGGCCACCGCATCCCGGCCT
-L--P--E--A--H--Q--R--T--W--H--A--W--M--D--N--I-----D--W--C--I--S--R--Q--L--W--W--G--H--R--I--P--A--

-------------------------------------------><-------------------------------------------------------
Y--F--V--T--V--S--D--P--A--V--P--P--G--E--D--P--D--G--R--Y--W--V--S--G--R--N--E--A--E--A--R--E--K--A
ACTTTGTCACTGTCAGTGACCCAGCGGTGCCCCCTGGGGAGGACCCTGATGGGCGGTACTGGGTGAGTGGACGCAATGAGGCGGAGGCCCGGGAGAAGGC
::::.:::::.:::::.:::::.:: :: ::::: ::::::::::::::::::::::::::::: :::::.:::: .::::: :::::.:: ::::::::
ACTTCGTCACCGTCAGCGACCCGGCTGTCCCCCCAGGGGAGGACCCTGATGGGCGGTACTGGGTCAGTGGGCGCACCGAGGCCGAGGCTCGCGAGAAGGC
Y--F--V--T--V--S--D--P--A--V--P--P--G--E--D--P--D--G--R--Y--W--V--S--G--R--T--E--A--E--A--R--E--K--A

-------------------------------------><----------><-------------------------------------------------
--A--K--E--F--G--V--S--P--D--K--I--R--S--G--G--N--E--D--V--L--D--T--W--F--S--S--G--L--F--P--L--S--I-
AGCCAAGGAGTTCGGAGTGTCCCCTGACAAGATCAGGTCTGGAGGGAATGAGGATGTATTGGATACCTGGTTCTCCTCTGGCCTCTTCCCCTTATCCATT
::::::::::::.:: :::::::: :::::::::               ::.::.:::.::::.::.:::::::::::.:::::::::::::: :::::.
AGCCAAGGAGTTTGGCGTGTCCCCGGACAAGATC---------------GAAGACGTACTGGACACTTGGTTCTCCTCCGGCCTCTTCCCCTTCTCCATC
--A--K--E--F--G--V--S--P--D--K--I-----------------E--D--V--L--D--T--W--F--S--S--G--L--F--P--F--S--I-

--------------------><------------------------------------------------------------------------------
-L--G--W--P--N--Q--S--E--D--L--S--V--F--Y--P--G--T--L--L--E--T--G--H--D--I--L--F--F--W--V--A--R--M--
TTGGGCTGGCCCAACCAGTCAGAAGACCTGAGTGTGTTCTACCCCGGGACACTGCTGGAGACCGGTCATGACATCCTCTTCTTCTGGGTGGCCCGGATGG
.:::::::::::::::::::::::::.:::::::::::::::::.::::::::::::::::: ::.::::::::::::::::::::::::::: ::::::
CTGGGCTGGCCCAACCAGTCAGAAGATCTGAGTGTGTTCTACCCTGGGACACTGCTGGAGACGGGCCATGACATCCTCTTCTTCTGGGTGGCCAGGATGG
-L--G--W--P--N--Q--S--E--D--L--S--V--F--Y--P--G--T--L--L--E--T--G--H--D--I--L--F--F--W--V--A--R--M--

----------------------------------------------><----------------------------------------------------
V--M--L--G--L--K--L--T--G--R--L--P--F--R--E--V--Y--L--H--A--I--V--R--D--A--H--G--R--K--M--S--K--S--L
TCATGCTGGGCCTGAAGCTCACGGGCAGGCTGCCCTTTAGAGAGGTCTACCTCCATGCCATCGTGCGAGATGCTCACGGCCGGAAGATGAGCAAGTCTCT
::::::: :::::::::::::: ::::.:::.:::::.:.:::::::::.:::::.:::::::::::.:::::.::::::::::::::::::::::::::
TCATGCTCGGCCTGAAGCTCACTGGCAAGCTACCCTTCAAAGAGGTCTATCTCCACGCCATCGTGCGGGATGCCCACGGCCGGAAGATGAGCAAGTCTCT
V--M--L--G--L--K--L--T--G--K--L--P--F--K--E--V--Y--L--H--A--I--V--R--D--A--H--G--R--K--M--S--K--S--L

---------------------------------------------------><-----------------------------------------------
--G--N--V--I--D--P--L--D--V--I--Y--G--I--S--L--Q--G--L--H--N--Q--L--L--N--S--N--L--D--P--S--E--V--E-
AGGCAATGTCATCGATCCCCTGGACGTCATCTATGGAATCTCCCTGCAGGGCCTCCACAACCAGCTGCTGAACAGCAACCTGGATCCCAGCGAGGTGGAG
.:::::.::::::::.:::::::::::::::.:.:: .:::::::::::::::: :::::::::::: ::::::::::::::::::::::.:::.:::::
GGGCAACGTCATCGACCCCCTGGACGTCATCCACGGCGTCTCCCTGCAGGGCCTGCACAACCAGCTGGTGAACAGCAACCTGGATCCCAGTGAGATGGAG
--G--N--V--I--D--P--L--D--V--I--H--G--V--S--L--Q--G--L--H--N--Q--L--V--N--S--N--L--D--P--S--E--M--E-

--------------------><----------------------------------------------------------------------------->
-K--A--K--E--G--Q--K--A--D--F--P--A--G--I--P--E--C--G--T--D--A--L--R--F--G--L--C--A--Y--M--S--Q--G--
AAGGCCAAAGAAGGGCAGAAAGCTGACTTCCCAGCGGGGATTCCTGAATGTGGCACCGATGCTCTCCGGTTTGGATTATGTGCCTACATGTCCCAGGGTC
:::::::::::.::::::::.:: ::.::::::::::::::.::.:::::.::::::::.:::::::: ::::::.:.::.:::::::. :: :::   :
AAGGCCAAAGAGGGGCAGAAGGCAGATTTCCCAGCGGGGATCCCCGAATGCGGCACCGACGCTCTCCGCTTTGGACTGTGCGCCTACACCTCGCAG---C
-K--A--K--E--G--Q--K--A--D--F--P--A--G--I--P--E--C--G--T--D--A--L--R--F--G--L--C--A--Y--T--S--Q-----

<---------------------------------------------------------------------------------------------------
R--D--I--N--L--D--V--N--R--I--L--G--Y--R--H--F--C--N--K--L--W--N--A--T--K--F--A--L--R--G--L--G--K--G
GTGACATCAACCTGGATGTGAACCGGATACTGGGTTACCGCCACTTCTGCAACAAGCTCTGGAATGCCACCAAGTTTGCCCTTCGTGGCCTTGGGAAGGG
::::.::::::::::::::::::::::::::::: ::::::::.::::::::::::::::::::.:::::::::::::::::.:::::::::::::::::
GTGATATCAACCTGGATGTGAACCGGATACTGGGGTACCGCCATTTCTGCAACAAGCTCTGGAACGCCACCAAGTTTGCCCTCCGTGGCCTTGGGAAGGG
R--D--I--N--L--D--V--N--R--I--L--G--Y--R--H--F--C--N--K--L--W--N--A--T--K--F--A--L--R--G--L--G--K--G

---------------------------><-----------------------------------------------------------------------
--F--V--P--S--P--T--S--Q--P--G--G--H--E--S--L--V--D--R--W--I--R--S--R--L--T--E--A--V--R--L--S--N--Q-
TTTTGTGCCCTCACCCACCTCCCAGCCCGGAGGCCATGAGAGCCTGGTGGACCGCTGGATCCGCAGCCGCCTGACAGAGGCTGTGAGGCTCAGCAATCAA
:::.:: :::::  :::::::: ::::.:::::::..::::::::::.::::::::::::::::::::: ::::: :::::.::::::::::::::.::.
TTTCGTCCCCTCCGCCACCTCCGAGCCTGGAGGCCGCGAGAGCCTGGCGGACCGCTGGATCCGCAGCCGGCTGACTGAGGCCGTGAGGCTCAGCAACCAG
--F--V--P--S--A--T--S--E--P--G--G--R--E--S--L--A--D--R--W--I--R--S--R--L--T--E--A--V--R--L--S--N--Q-

-----------------------------------------------------------------------------------><---------------
-G--F--Q--A--Y--D--F--P--A--V--T--T--A--Q--Y--S--F--W--L--Y--E--L--C--D--V--Y--L--E--C--L--K--P--V--
GGCTTCCAGGCCTACGACTTCCCGGCCGTCACCACTGCCCAGTACAGCTTCTGGCTCTATGAGCTCTGTGATGTCTACTTGGAGTGCCTGAAACCTGTAC
::.::::::::::::::::::::::::::::::::::::::::::::::::::::: ::.:::::::::::.::::::.:::::::::::::.:::::.:
GGTTTCCAGGCCTACGACTTCCCGGCCGTCACCACTGCCCAGTACAGCTTCTGGCTGTACGAGCTCTGTGACGTCTACCTGGAGTGCCTGAAGCCTGTGC
-G--F--Q--A--Y--D--F--P--A--V--T--T--A--Q--Y--S--F--W--L--Y--E--L--C--D--V--Y--L--E--C--L--K--P--V--

----------------------------------------------------------------------------------------------------
L--N--G--V--D--Q--V--A--A--E--C--A--R--Q--T--L--Y--T--C--L--D--V--G--L--R--L--L--S--P--F--M--P--F--V
TGAATGGGGTGGACCAGGTGGCAGCTGAGTGTGCCCGCCAGACCCTGTACACTTGCCTGGACGTTGGCCTGCGGCTGCTCTCACCCTTCATGCCCTTCGT
::::.:::::::::::::::::.::.::: :.:::::::::::::: :::::.:::.:::::::.::::::::::::::::::::.::::::::::::::
TGAACGGGGTGGACCAGGTGGCGGCCGAGAGCGCCCGCCAGACCCTCTACACCTGCTTGGACGTCGGCCTGCGGCTGCTCTCACCTTTCATGCCCTTCGT
L--N--G--V--D--Q--V--A--A--E--S--A--R--Q--T--L--Y--T--C--L--D--V--G--L--R--L--L--S--P--F--M--P--F--V

------------------------------------------------------------------------------------------><--------
--T--E--E--L--F--Q--R--L--P--R--R--M--P--Q--A--P--P--S--L--C--V--T--P--Y--P--E--P--S--E--C--S--W--K-
GACGGAGGAGCTGTTCCAGAGGCTGCCCCGGAGGATGCCGCAAGCTCCCCCTAGCCTCTGTGTTACCCCCTACCCGGAGCCCTCAGAGTGCTCCTGGAAG
::: :::::::::::.::::::::::::::: :::.::::::.::.:::::::::::::::::.:::.:::::::::::::.::::::::::::::::::
GACCGAGGAGCTGTTTCAGAGGCTGCCCCGGCGGACGCCGCAGGCCCCCCCTAGCCTCTGTGTCACCTCCTACCCGGAGCCTTCAGAGTGCTCCTGGAAG
--T--E--E--L--F--Q--R--L--P--R--R--T--P--Q--A--P--P--S--L--C--V--T--S--Y--P--E--P--S--E--C--S--W--K-

----------------------------------------------------------------------------------------------------
-D--P--E--A--E--A--A--L--E--L--A--L--S--I--T--R--A--V--R--S--L--R--A--D--Y--N--L--T--R--I--R--P--D--
GACCCCGAGGCAGAAGCCGCCCTTGAGCTGGCGCTAAGCATCACGCGAGCCGTGCGCTCCCTGCGGGCCGACTACAACCTCACCCGGATCCGGCCTGACT
::::::::::::::.::::::.:.:::::::: ::.:::::::: :::::.::::::::::: :: :::::::::::::::::::::::::::::.::: 
GACCCCGAGGCAGAGGCCGCCTTCGAGCTGGCCCTGAGCATCACTCGAGCTGTGCGCTCCCTCCGTGCCGACTACAACCTCACCCGGATCCGGCCCGAC-
-D--P--E--A--E--A--A--F--E--L--A--L--S--I--T--R--A--V--R--S--L--R--A--D--Y--N--L--T--R--I--R--P--D--

--><------------------------------------------------------------------------------------------------
C--F--L--E--V--A--D--E--A--T--G--A--L--A--S--A--V--S--G--Y--V--Q--A--L--A--S--A--G--V--V--A--V--L--A
GTTTCCTGGAAGTGGCGGATGAGGCCACGGGCGCCCTGGCATCGGCGGTGTCGGGCTACGTGCAGGCCCTGGCCAGCGCAGGTGTGGTGGCTGTTCTGGC
  :::::::::::::: ::::::::::::::.::::::::::::::.:::::.::::::::::::.: ::::::::::: :::.:.::.:::::::::::
--TTCCTGGAAGTGGCTGATGAGGCCACGGGTGCCCTGGCATCGGCAGTGTCAGGCTACGTGCAGACGCTGGCCAGCGCTGGTATAGTAGCTGTTCTGGC
---F--L--E--V--A--D--E--A--T--G--A--L--A--S--A--V--S--G--Y--V--Q--T--L--A--S--A--G--I--V--A--V--L--A

----------------------------------------------------------------------------------------------------
--L--G--A--P--A--P--Q--G--C--A--V--A--L--A--S--D--R--C--S--I--H--L--Q--L--Q--G--L--V--D--P--A--R--E-
CCTGGGGGCTCCCGCCCCCCAGGGTTGCGCTGTGGCTCTGGCTTCTGATCGCTGCTCCATCCACCTGCAGCTTCAGGGGCTGGTGGACCCTGCACGGGAG
.:::::::::.:.:: ::::::::.::.::::::::.:::::.:::::.:::::::::.::::::::::::: :::::::::::.:::::.:: ::::::
TCTGGGGGCTTCTGCACCCCAGGGCTGTGCTGTGGCCCTGGCCTCTGACCGCTGCTCCGTCCACCTGCAGCTGCAGGGGCTGGTAGACCCCGCCCGGGAG
--L--G--A--S--A--P--Q--G--C--A--V--A--L--A--S--D--R--C--S--V--H--L--Q--L--Q--G--L--V--D--P--A--R--E-

----------------------------------------------------------------------------------------------------
-L--G--K--L--Q--A--K--R--V--E--A--Q--R--Q--A--Q--R--L--R--E--R--R--A--A--S--G--Y--P--V--K--V--P--L--
CTGGGCAAGCTGCAAGCCAAGCGAGTTGAGGCCCAGCGGCAGGCCCAGCGTCTGCGGGAACGCCGTGCTGCCTCGGGCTATCCTGTCAAGGTGCCGCTCG
::::::::.:::::.:::::::: : .::::: ::::::::::::::::::::::.:::.::::::::.::::: .::::..::::::::::::: :::.
CTGGGCAAACTGCAGGCCAAGCGTGACGAGGCGCAGCGGCAGGCCCAGCGTCTGCAGGAGCGCCGTGCCGCCTCCAGCTACTCTGTCAAGGTGCCCCTCA
-L--G--K--L--Q--A--K--R--D--E--A--Q--R--Q--A--Q--R--L--Q--E--R--R--A--A--S--S--Y--S--V--K--V--P--L--

----------------------------><-----------------------------------------------------------------
E--V--Q--E--A--D--E--A--K--L--Q--Q--T--E--A--E--L--R--K--V--D--E--A--I--A--L--F--Q--K--M--L--*-
AAGTCCAGGAGGCAGATGAAGCCAAGCTCCAACAGACAGAAGCAGAGCTCAGGAAGGTGGATGAGGCCATCGCCCTATTCCAGAAGATGCTGTGA
::::::::::::::::::::::.::::::::.:::::.::::::::::::::::::::::: :::::::::::::::::.:::::::::::::::
AAGTCCAGGAGGCAGATGAAGCTAAGCTCCAGCAGACGGAAGCAGAGCTCAGGAAGGTGGAGGAGGCCATCGCCCTATTTCAGAAGATGCTGTGA
K--V--Q--E--A--D--E--A--K--L--Q--Q--T--E--A--E--L--R--K--V--E--E--A--I--A--L--F--Q--K--M--L--*-

Pig Consensus Sequence

>BGISUST0000885761
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------GTCCTGGATCCCTCTGCCCGGCGGATCTGGGGCAATGTGACCCGCTGGTTTATCACCTGTGTCCAGCAGCCAGAATTC
CGGGCCGTGCTAGGAGAGGTGGTTCTGTTCTCAGGGACCAGGCCTGCCTCCCAACAGCCA---CCCGAGGTCTCTGCACCCACAAAGACAGCCGCTCAAC
TCAAGAAAGAGGCAAAAAAGCGGGAGAAGTTAGAGAAATTCCAACAGAAACAGAAGATCCAGCAGCAGCAGCCACCCCCTGGGGAGAAGAAACCAAAACC
AGAGAAGAGGGAGAAACGGGATCCTGGGGTCATTACCTATGACCTCCCAACCCCCCCTGGGGAGAAGAAA---GTCAGTGGCACGATGCCCGACTCCTAC
AGCCCTCAGTACGTCGAGGCTGCCTGGTACCCTTGGTGGGAGCGGCAGGGCTTCTTCAAGCCCGAGTATGGGCGTTCCAGCGTGTCTGCCCCCAACCCCC
GGGGCACCTTCATGATGTGCATCCCGCCCCCCAACGTGACAGGCTCCCTGCACCTGGGCCACGCGCTCACcgCCATCCAGGACTCCCTGACCCGA---CA
CCGCATGCGCGGCGAGACCACCCTGTGGAACCCAGGCTGCGACCATGCGGGC------------------------------------------------
---------------------------------------------------------------AAAGGTGACCGGATTTACCACCAGCTGAAGAAGCTCG
GCAGCTCCTTGGACTGGGATCGGGCCTGTTTCACCATGGAT---AAACTGTCAGCAACCGTGATCGAGGCCTTCGTCCGGCTCCACGAGGAAGGCGTCAT
CTACCGCAGTACCCGCCTTGTCAACTGGTCCTGCACCCTCAACTCTGCCATCTCGGACATCGAGGTGGATAAGAAGGAGCTGACGGGCCGCACGTTGCTG
TCCGTGCCTGGTTACAAGGAGAAGGTGGAGTTTGGGGTCCTCGTCTCCTTTGCCTACAAGGTCCAAGGCTCA---AGCGACGAGGAGGTGGTGGTGGCAA
CAACTCGGATCGAGACCATGCTGGGAGACGTGGCTATAGCTGTGCACCCCGAAGACCCCAGATACCAGCACCTGAAGGGGAAGAGCGTGGTCCACCCATT
CGTGTCCCGGAGCCTCCCCGTCATCTTCGATGATTTTGTGGACATGGAGTTTGGCACA---GCGGGGAAGATCACCCCCGCACACGACCAGAACGACTAC
GAGGTTGGGCAGCGGCACGGGCTGGAGGCCGTCAGCATCATGGACGCGCGAGGGGCCCTTGTCAACGTGCCCCCACCTTTCCTG---------AGGTTCG
AGGCCAGAAAGGCGGTGCTGGCGGCGCTAAAGGAGCGGGGACTCTTCCGCGGCGTTGAGGACAACCCCATGGTGGTGCCGCTTTGC---CGTTCCAAGGA
CGTGGTGGAGCCGCTGCTGCGGCCCCAGTGGTACGTGCGCTGTGGGGAGATGGCCCAGGCCGCCAGTGCTGCCGTGACGCGGGGCGACCTCCGCATCCTG
CCGGAAGCCCACCAGCGGACGTGGCATGCCTGGATGGACAACATC---GACTGGTGCATCTCCCGGCAGCTGTGGTGGGGCCACCGCATCCCGGCCTACT
TCGTCACCGTCAGCGACCCGGCTGTCCCCCCAGGGGAGGACCCTGATGGGCGGTACTGGGTCAGTGGGCGCACCGAGGCCGAGGCTCGCGAGAAGGCAGC
CAAGGAGTTTGGCGTGTCCCCGGACAAGATC---------------GAAGACGTACTGGACACTTGGTTCTCCTCCGGCCTCTTCCCCTTCTCCATCCTG
GGCTGGCCCAACCAGTCAGAAGATCTGAGTGTGTTCTACCCTGGGACACTGCTGGAGACGGGCCATGACATCCTCTTCTTCTGGGTGGCCAGGATGGTCA
TGCTCGGCCTGAAGCTCACTGGCAAGCTACCCTTCAAAGAGGTCTATCTCCACGCCATCGTGCGGGATGCCCACGGCCGGAAGATGAGCAAGTCTCTGGG
CAACGTCATCGACCCCCTGGACGTCATCCACGGCGTCTCCCTGCAGGGCCTGCACAACCAGCTGGTGAACAGCAACCTGGATCCCAGTGAGATGGAGAAG
GCCAAAGAGGGGCAGAAGGCAGATTTCCCAGCGGGGATCCCCGAATGCGGCACCGACGCTCTCCGCTTTGGACTGTGCGCCTACACCTCGCAG---CGTG
ATATCAACCTGGATGTGAACCGGATACTGGGGTACCGCCATTTCTGCAACAAGCTCTGGAACGCCACCAAGTTTGCCCTCCGTGGCCTTGGGAAGGGTTT
CGTCCCCTCCGCCACCTCCGAGCCTGGAGGCCGCGAGAGCCTGGCGGACCGCTGGATCCGCAGCCGGCTGACTGAGGCCGTGAGGCTCAGCAACCAGGGT
TTCCAGGCCTACGACTTCCCGGCCGTCACCACTGCCCAGTACAGCTTCTGGCTGTACGAGCTCTGTGACGTCTACCTGGAGTGCCTGAAGCCTGTGCTGA
ACGGGGTGGACCAGGTGGCGGCCGAGAGCGCCCGCCAGACCCTCTACACCTGCTTGGACGTCGGCCTGCGGCTGCTCTCACCTTTCATGCCCTTCGTGAC
CGAGGAGCTGTTTCAGAGGCTGCCCCGGCGGACGCCGCAGGCCCCCCCTAGCCTCTGTGTCACCTCCTACCCGGAGCCTTCAGAGTGCTCCTGGAAGGAC
CCCGAGGCAGAGGCCGCCTTCGAGCTGGCCCTGAGCATCACTCGAGCTGTGCGCTCCCTCCGTGCCGACTACAACCTCACCCGGATCCGGCCCGAC---T
TCCTGGAAGTGGCTGATGAGGCCACGGGTGCCCTGGCATCGGCAGTGTCAGGCTACGTGCAGACGCTGGCCAGCGCTGGTATAGTAGCTGTTCTGGCTCT
GGGGGCTTCTGCACCCCAGGGCTGTGCTGTGGCCCTGGCCTCTGACCGCTGCTCCGTCCACCTGCAGCTGCAGGGGCTGGTAGACCCCGCCCGGGAGCTG
GGCAAACTGCAGGCCAAGCGTGACGAGGCGCAGCGGCAGGCCCAGCGTCTGCAGGAGCGCCGTGCCGCCTCCAGCTACTCTGTCAAGGTGCCCCTCAAAG
TCCAGGAGGCAGATGAAGCTAAGCTCCAGCAGACGGAAGCAGAGCTCAGGAAGGTGGAGGAGGCCATCGCCCTATTTCAGAAGATGCTGTGA


>BGISUSP0000885761
----------------------------------------------------------------------------------------------------
--------------------------------------------------------------------------VLDPSARRIWGNVTRWFITCVQQPEF
RAVLGEVVLFSGTRPASQQP-PEVSAPTKTAAQLKKEAKKREKLEKFQQKQKIQQQQPPPGEKKPKPEKREKRDPGVITYDLPTPPGEKK-VSGTMPDSY
SPQYVEAAWYPWWERQGFFKPEYGRSSVSAPNPRGTFMMCIPPPNVTGSLHLGHALTAIQDSLTR-HRMRGETTLWNPGCDHAG----------------
---------------------KGDRIYHQLKKLGSSLDWDRACFTMD-KLSATVIEAFVRLHEEGVIYRSTRLVNWSCTLNSAISDIEVDKKELTGRTLL
SVPGYKEKVEFGVLVSFAYKVQGS-SDEEVVVATTRIETMLGDVAIAVHPEDPRYQHLKGKSVVHPFVSRSLPVIFDDFVDMEFGT-AGKITPAHDQNDY
EVGQRHGLEAVSIMDARGALVNVPPPFL---RFEARKAVLAALKERGLFRGVEDNPMVVPLC-RSKDVVEPLLRPQWYVRCGEMAQAASAAVTRGDLRIL
PEAHQRTWHAWMDNI-DWCISRQLWWGHRIPAYFVTVSDPAVPPGEDPDGRYWVSGRTEAEAREKAAKEFGVSPDKI-----EDVLDTWFSSGLFPFSIL
GWPNQSEDLSVFYPGTLLETGHDILFFWVARMVMLGLKLTGKLPFKEVYLHAIVRDAHGRKMSKSLGNVIDPLDVIHGVSLQGLHNQLVNSNLDPSEMEK
AKEGQKADFPAGIPECGTDALRFGLCAYTSQ-RDINLDVNRILGYRHFCNKLWNATKFALRGLGKGFVPSATSEPGGRESLADRWIRSRLTEAVRLSNQG
FQAYDFPAVTTAQYSFWLYELCDVYLECLKPVLNGVDQVAAESARQTLYTCLDVGLRLLSPFMPFVTEELFQRLPRRTPQAPPSLCVTSYPEPSECSWKD
PEAEAAFELALSITRAVRSLRADYNLTRIRPD-FLEVADEATGALASAVSGYVQTLASAGIVAVLALGASAPQGCAVALASDRCSVHLQLQGLVDPAREL
GKLQAKRDEAQRQAQRLQERRAASSYSVKVPLKVQEADEAKLQQTEAELRKVEEAIALFQKML*