Sequences
EST Library Info
aor1Aorta
cje1Jejunum - RNA from China
cly1Lymph - RNA from China
cov1Ovary - RNA from China
csp1Spleen - RNA from China
cst3Stomach - RNA from China
eep4Foetus 50 days, epidermis
eje5Foetus 50 days, jejunum
eru1Foetus 50 days, regio umbilicalis
ese1Foetus 50 days, M. semitendinosus
eye2Foetus 50 days, Eye
hyp1Hypothalamus
lnt4Lymphatic nodule tracheobroncalis
med5Mediastinum
nbm1Newborn 115 days, bone marrow (pelvis)
nca3Newborn 115 days, cartillage
nco4Newborn 115 days, colon
nep1Newborn 115 days, epidermis
nje4Newborn 115 days, jejunum
nlu3Newborn 115 days, lung
nmm2Newborn 115 days, mucosal membranes
pgl6Pituitary gland
pigcb1Unavailable
plac4Unavailable
relu5Unavailable
ton3Tip of tongue, mucosal membrane
ute6Uterus
Clusters
Oligos
SNPs

Gene ID ENSG00000096238 (click for geneview)
Transcript ID ENST00000211475(link to ensembl)
Symbol CLIC1
Localtion Chromosome:6:31806339:31813074:-1 band: 6p21.33
Description Chloride intracellular channel protein 1 (Nuclear chloride ion channel 27) (NCC27) (p64 CLCP) (Chloride channel ABP) (Regulatory nuclear chloride ion channel protein) (hRNCC). [Source:Uniprot/SWISSPROT;Acc:O00299]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-------------------------------------><------------------------------------------------------------
-M--A--E--E--Q--P--Q--V--E--L--F--V--K--A--G--S--D--G--A--K--I--G--N--C--P--F--S--Q--R--L--F--M--V--
ATGGCTGAAGAACAACCGCAGGTCGAATTGTTCGTGAAGGCTGGCAGTGATGGGGCCAAGATTGGGAACTGCCCATTCTCCCAGAGACTGTTCATGGTAC
::::::::::::::::: :::::::::::::::::.::::::::::::::::::::::::::.::.:::::::: :::::::::::::::::::::::.:
ATGGCTGAAGAACAACCTCAGGTCGAATTGTTCGTAAAGGCTGGCAGTGATGGGGCCAAGATCGGAAACTGCCCCTTCTCCCAGAGACTGTTCATGGTGC
-M--A--E--E--Q--P--Q--V--E--L--F--V--K--A--G--S--D--G--A--K--I--G--N--C--P--F--S--Q--R--L--F--M--V--

------------------------------------------------><--------------------------------------------------
L--W--L--K--G--V--T--F--N--V--T--T--V--D--T--K--R--R--T--E--T--V--Q--K--L--C--P--G--G--Q--L--P--F--L
TGTGGCTCAAGGGAGTCACCTTCAATGTTACCACCGTTGACACCAAAAGGCGGACCGAGACAGTGCAGAAGCTGTGCCCAGGGGGGCAGCTCCCATTCCT
: ::::::::::::::.:::::::::::.:::::.:: ::::::      :::::.:::::.::::::::.::::::::::::::.:::::::: :::::
TCTGGCTCAAGGGAGTTACCTTCAATGTCACCACTGTGGACACC------CGGACTGAGACGGTGCAGAAACTGTGCCCAGGGGGACAGCTCCCTTTCCT
L--W--L--K--G--V--T--F--N--V--T--T--V--D--T--------R--T--E--T--V--Q--K--L--C--P--G--G--Q--L--P--F--L

--------------------------------------------------------------------------><------------------------
--L--Y--G--T--E--V--H--T--D--T--N--K--I--E--E--F--L--E--A--V--L--C--P--P--R--Y--P--K--L--A--A--L--N-
GCTGTATGGCACTGAAGTGCACACAGACACCAACAAGATTGAGGAATTTCTGGAGGCAGTGCTGTGCCCTCCCAGGTACCCCAAGCTGGCAGCTCTGAAC
::::::.::::::::::::::::::::.:::::::::::.:::::::::::::::::::::::.:::::::::   ::::::::::::::::::::::::
GCTGTACGGCACTGAAGTGCACACAGATACCAACAAGATCGAGGAATTTCTGGAGGCAGTGCTATGCCCTCCC---TACCCCAAGCTGGCAGCTCTGAAC
--L--Y--G--T--E--V--H--T--D--T--N--K--I--E--E--F--L--E--A--V--L--C--P--P-----Y--P--K--L--A--A--L--N-

---------------------------------------------------------------------------------><-----------------
-P--E--S--N--T--A--G--L--D--I--F--A--K--F--S--A--Y--I--K--N--S--N--P--A--L--N--D--N--L--E--K--G--L--
CCTGAGTCCAACACAGCTGGGCTGGACATATTTGCCAAATTTTCTGCCTACATCAAGAATTCAAACCCAGCACTCAATGACAATCTGGAGAAGGGACTCC
:::::.:::::::::::::::::::::::::::::.:::::::::::::::::.::::::::::::::::: :::::::::   :::::::::::.::::
CCTGAATCCAACACAGCTGGGCTGGACATATTTGCTAAATTTTCTGCCTACATTAAGAATTCAAACCCAGCTCTCAATGAC---CTGGAGAAGGGGCTCC
-P--E--S--N--T--A--G--L--D--I--F--A--K--F--S--A--Y--I--K--N--S--N--P--A--L--N--D-----L--E--K--G--L--

----------------------------------------------------------------------------------------------------
L--K--A--L--K--V--L--D--N--Y--L--T--S--P--L--P--E--E--V--D--E--T--S--A--E--D--E--G--V--S--Q--R--K--F
TGAAAGCCCTGAAGGTTTTAGACAATTACTTAACATCCCCCCTCCCAGAAGAAGTGGATGAAACCAGTGCTGAAGATGAAGGTGTCTCTCAGAGGAAGTT
:::::::::::::.::.::::::::::::::.::::::::.::::::::::::::::::::.:::::::::::.:::::.::..::::::::::::::::
TGAAAGCCCTGAAAGTCTTAGACAATTACTTGACATCCCCTCTCCCAGAAGAAGTGGATGAGACCAGTGCTGAGGATGAGGGCATCTCTCAGAGGAAGTT
L--K--A--L--K--V--L--D--N--Y--L--T--S--P--L--P--E--E--V--D--E--T--S--A--E--D--E--G--I--S--Q--R--K--F

---------------------------------------------------------------><-----------------------------------
--L--D--G--N--E--L--T--L--A--D--C--N--L--L--P--K--L--H--I--V--Q--V--V--C--K--K--Y--R--G--F--T--I--P-
TTTGGATGGCAACGAGCTCACCCTGGCTGACTGCAACCTGTTGCCAAAGTTACACATAGTACAGGTGGTGTGTAAGAAGTACCGGGGATTCACCATCCCC
:.::::::::::.::::::::..::::::::::::::::::::::::::.: ::::::::::::::::: ::::::::::::::::::::: ::::.:: 
TCTGGATGGCAATGAGCTCACTTTGGCTGACTGCAACCTGTTGCCAAAGCTCCACATAGTACAGGTGGTCTGTAAGAAGTACCGGGGATTCTCCATTCCG
--L--D--G--N--E--L--T--L--A--D--C--N--L--L--P--K--L--H--I--V--Q--V--V--C--K--K--Y--R--G--F--S--I--P-

----------------------------------------------------------------------------------------------------
-E--A--F--R--G--V--H--R--Y--L--S--N--A--Y--A--R--E--E--F--A--S--T--C--P--D--D--E--E--I--E--L--A--Y--
GAGGCCTTCCGGGGAGTGCATCGGTACTTGAGCAATGCCTACGCCCGGGAAGAATTCGCTTCCACCTGTCCAGATGATGAGGAGATCGAGCTCGCCTATG
:: :: ::.:: :::::::::::.:::.:: ::::::::::.::.::::::::.::.::.::::::::::::::.::::::::::::::::: :::::.:
GATGCGTTTCGTGGAGTGCATCGATACCTGCGCAATGCCTATGCTCGGGAAGAGTTTGCCTCCACCTGTCCAGACGATGAGGAGATCGAGCTGGCCTACG
-D--A--F--R--G--V--H--R--Y--L--R--N--A--Y--A--R--E--E--F--A--S--T--C--P--D--D--E--E--I--E--L--A--Y--

------------------------->
E--Q--V--A--K--A--L--K--*-
AGCAAGTGGCAAAGGCCCTCAAATAA
:::::::::: :::::::::::::::
AGCAAGTGGCCAAGGCCCTCAAATAA
E--Q--V--A--K--A--L--K--*-

Pig Consensus Sequence

>BGISUST0000880103
ATGGCTGAAGAACAACCTCAGGTCGAATTGTTCGTAAAGGCTGGCAGTGATGGGGCCAAGATCGGAAACTGCCCCTTCTCCCAGAGACTGTTCATGGTGC
TCTGGCTCAAGGGAGTTACCTTCAATGTCACCACTGTGGACACC------CGGACTGAGACGGTGCAGAAACTGTGCCCAGGGGGACAGCTCCCTTTCCT
GCTGTACGGCACTGAAGTGCACACAGATACCAACAAGATCGAGGAATTTCTGGAGGCAGTGCTATGCCCTCCC---TACCCCAAGCTGGCAGCTCTGAAC
CCTGAATCCAACACAGCTGGGCTGGACATATTTGCTAAATTTTCTGCCTACATTAAGAATTCAAACCCAGCTCTCAATGAC---CTGGAGAAGGGGCTCC
TGAAAGCCCTGAAAGTCTTAGACAATTACTTGACATCCCCTCTCCCAGAAGAAGTGGATGAGACCAGTGCTGAGGATGAGGGCATCTCTCAGAGGAAGTT
TCTGGATGGCAATGAGCTCACTTTGGCTGACTGCAACCTGTTGCCAAAGCTCCACATAGTACAGGTGGTCTGTAAGAAGTACCGGGGATTCTCCATTCCG
GATGCGTTTCGTGGAGTGCATCGATACCTGCGCAATGCCTATGCTCGGGAAGAGTTTGCCTCCACCTGTCCAGACGATGAGGAGATCGAGCTGGCCTACG
AGCAAGTGGCCAAGGCCCTCAAATAA


>BGISUSP0000880103
MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDT--RTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPP-YPKLAALN
PESNTAGLDIFAKFSAYIKNSNPALND-LEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGISQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFSIP
DAFRGVHRYLRNAYAREEFASTCPDDEEIELAYEQVAKALK*