Sequences
EST Library Info
csp1Spleen - RNA from China
dbla1Unavailable
jca1Joint capsule
lin1Large intestine
mcp1Mammae, collostrum producing
med2Mediastinum
nca2Newborn 115 days, cartillage
nje2Newborn 115 days, jejunum
pigca2Unavailable
pigcb2Unavailable
pliv1Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000100554 (click for geneview)
Transcript ID ENST00000216442(link to ensembl)
Symbol ATP6V1D
Localtion Chromosome:14:66874343:66896344:-1 band: 14q23.3
Description Vacuolar ATP synthase subunit D (EC 3.6.3.14) (V-ATPase D subunit) (Vacuolar proton pump D subunit) (V-ATPase 28 kDa accessory protein). [Source:Uniprot/SWISSPROT;Acc:Q9Y5K8]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------><----------------------------------------------------------
-M--S--G--K--D--R--I--E--I--F--P--S--R--M--A--Q--T--I--M--K--A--R--L--K--G--A--Q--T--G--R--N--L--L--
ATGTCGGGCAAAGACCGAATTGAAATCTTTCCCTCGCGAATGGCACAGACCATCATGAAGGCTCGTTTAAAGGGAGCACAGACAGGTCGAAACCTCCTGA
:::::::::::::::::::::::::::::::::::::::   ::::::::::::::::::::::: :::::.::::::::.:::::::::::::::::::
ATGTCGGGCAAAGACCGAATTGAAATCTTTCCCTCGCGA---GCACAGACCATCATGAAGGCTCGGTTAAAAGGAGCACAAACAGGTCGAAACCTCCTGA
-M--S--G--K--D--R--I--E--I--F--P--S--R-----A--Q--T--I--M--K--A--R--L--K--G--A--Q--T--G--R--N--L--L--

----------------------------------------------------------><----------------------------------------
K--K--K--S--D--A--L--T--L--R--F--R--Q--I--L--K--K--I--I--E--T--K--M--L--M--G--E--V--M--R--E--A--A--F
AGAAAAAATCTGATGCCTTAACTCTTCGATTTCGACAGATCCTAAAGAAGATAATAGAGACTAAAATGTTGATGGGCGAAGTGATGAGAGAAGCTGCCTT
::::::::::::::::::::::::::::::::::::::::::: ::::::::::::::::::::.:::.:::::::.::.::::::::::::::::::::
AGAAAAAATCTGATGCCTTAACTCTTCGATTTCGACAGATCCTTAAGAAGATAATAGAGACTAAGATGCTGATGGGTGAGGTGATGAGAGAAGCTGCCTT
K--K--K--S--D--A--L--T--L--R--F--R--Q--I--L--K--K--I--I--E--T--K--M--L--M--G--E--V--M--R--E--A--A--F

--------------------------------------><------------------------------------------------------------
--S--L--A--E--A--K--F--T--A--G--D--F--S--T--T--V--I--Q--N--V--N--K--A--Q--V--K--I--R--A--K--K--D--N-
TTCACTAGCTGAAGCCAAGTTCACAGCAGGTGACTTCAGCACTACAGTTATCCAAAATGTCAATAAAGCGCAAGTGAAGATTCGAGCGAAGAAAGATAAT
.:::.:.:::::.:::::.::::::::::: ::::::   ::.::::::::::::::.:: :::::::: :::::::::::: ::::.::::::::::::
CTCATTGGCTGAGGCCAAATTCACAGCAGGGGACTTC---ACCACAGTTATCCAAAACGTAAATAAAGCCCAAGTGAAGATTAGAGCAAAGAAAGATAAT
--S--L--A--E--A--K--F--T--A--G--D--F-----T--T--V--I--Q--N--V--N--K--A--Q--V--K--I--R--A--K--K--D--N-

------><-------------------------------------------><-----------------------------------------------
-V--A--G--V--T--L--P--V--F--E--H--Y--H--E--G--T--D--S--Y--E--L--T--G--L--A--R--G--G--E--Q--L--A--K--
GTAGCAGGTGTTACTTTGCCAGTATTTGAACATTACCATGAAGGAACTGACAGTTATGAACTGACTGGTTTAGCCAGAGGTGGGGAACAGTTGGCTAAAT
::::::   :::::.:::::::::::::::::: :.:::::::::::::::   :::::.:::::::::::::::::::::::::::::::::::::::.
GTAGCA---GTTACCTTGCCAGTATTTGAACATAATCATGAAGGAACTGAC---TATGAGCTGACTGGTTTAGCCAGAGGTGGGGAACAGTTGGCTAAAC
-V--A-----V--T--L--P--V--F--E--H--N--H--E--G--T--D-----Y--E--L--T--G--L--A--R--G--G--E--Q--L--A--K--

-------------------------------------------------------><-------------------------------------------
L--K--R--N--Y--A--K--A--V--E--L--L--V--E--L--A--S--L--Q--T--S--F--V--T--L--D--E--A--I--K--I--T--N--R
TAAAGAGGAATTATGCCAAAGCAGTGGAACTACTGGTGGAACTAGCTTCTCTGCAGACTTCTTTTGTTACTTTGGATGAAGCTATTAAGATAACCAACAG
:.:::::::::::::::::::::::::::::.::::::::::::::::: :::::::::::.::::::::::::::::::::::::::::::::::::::
TGAAGAGGAATTATGCCAAAGCAGTGGAACTGCTGGTGGAACTAGCTTCGCTGCAGACTTCCTTTGTTACTTTGGATGAAGCTATTAAGATAACCAACAG
L--K--R--N--Y--A--K--A--V--E--L--L--V--E--L--A--S--L--Q--T--S--F--V--T--L--D--E--A--I--K--I--T--N--R

----------------------><----------------------------------------------------------------------------
--R--V--N--A--I--E--H--V--I--I--P--R--I--E--R--T--L--A--Y--I--I--T--E--L--D--E--R--E--R--E--E--F--Y-
GCGTGTAAATGCCATTGAACATGTCATCATTCCCCGGATTGAACGTACTCTTGCTTATATCATCACAGAGCTGGATGAGAGAGAGCGAGAAGAGTTCTAT
::::::::::::::::::::::   ::::::::.:::::::::::.::.:::::::::::::::::::::::::::::::::::::::::::::::::::
GCGTGTAAATGCCATTGAACAT---ATCATTCCTCGGATTGAACGCACCCTTGCTTATATCATCACAGAGCTGGATGAGAGAGAGCGAGAAGAGTTCTAT
--R--V--N--A--I--E--H-----I--I--P--R--I--E--R--T--L--A--Y--I--I--T--E--L--D--E--R--E--R--E--E--F--Y-

-><-------------------------------------------------------------------------------------------------
-R--L--K--K--I--Q--E--K--K--K--I--L--K--E--K--S--E--K--D--L--E--Q--R--R--A--A--G--E--V--L--E--P--A--
AGGTTAAAGAAAATACAAGAGAAGAAAAAGATTCTAAAGGAAAAATCTGAGAAGGACTTGGAGCAAAGGAGAGCAGCTGGAGAGGTGTTGGAGCCTGCTA
   :::::::::::::::::::::::::::::::: ::::::::.::::::::.::::::::.::: :.::.:::::::::::::.: ::::::::::::
---TTAAAGAAAATACAAGAGAAGAAAAAGATTCTCAAGGAAAAGTCTGAGAAAGACTTGGAACAACGAAGGGCAGCTGGAGAGGCGATGGAGCCTGCTA
----L--K--K--I--Q--E--K--K--K--I--L--K--E--K--S--E--K--D--L--E--Q--R--R--A--A--G--E--A--M--E--P--A--

------------------------------------------->
N--L--L--A--E--E--K--D--E--D--L--L--F--E--*-
ATCTTCTGGCTGAAGAGAAGGACGAGGATCTTCTATTTGAATAA
:::::::::::::.::::::::.:::::::::::.:::::::::
ATCTTCTGGCTGAGGAGAAGGATGAGGATCTTCTGTTTGAATAA
N--L--L--A--E--E--K--D--E--D--L--L--F--E--*-

Pig Consensus Sequence

>BGISUST0000878803
ATGTCGGGCAAAGACCGAATTGAAATCTTTCCCTCGCGA---GCACAGACCATCATGAAGGCTCGGTTAAAAGGAGCACAAACAGGTCGAAACCTCCTGA
AGAAAAAATCTGATGCCTTAACTCTTCGATTTCGACAGATCCTTAAGAAGATAATAGAGACTAAGATGCTGATGGGTGAGGTGATGAGAGAAGCTGCCTT
CTCATTGGCTGAGGCCAAATTCACAGCAGGGGACTTC---ACCACAGTTATCCAAAACGTAAATAAAGCCCAAGTGAAGATTAGAGCAAAGAAAGATAAT
GTAGCA---GTTACCTTGCCAGTATTTGAACATAATCATGAAGGAACTGAC---TATGAGCTGACTGGTTTAGCCAGAGGTGGGGAACAGTTGGCTAAAC
TGAAGAGGAATTATGCCAAAGCAGTGGAACTGCTGGTGGAACTAGCTTCGCTGCAGACTTCCTTTGTTACTTTGGATGAAGCTATTAAGATAACCAACAG
GCGTGTAAATGCCATTGAACAT---ATCATTCCTCGGATTGAACGCACCCTTGCTTATATCATCACAGAGCTGGATGAGAGAGAGCGAGAAGAGTTCTAT
---TTAAAGAAAATACAAGAGAAGAAAAAGATTCTCAAGGAAAAGTCTGAGAAAGACTTGGAACAACGAAGGGCAGCTGGAGAGGCGATGGAGCCTGCTA
ATCTTCTGGCTGAGGAGAAGGATGAGGATCTTCTGTTTGAATAA


>BGISUSP0000878803
MSGKDRIEIFPSR-AQTIMKARLKGAQTGRNLLKKKSDALTLRFRQILKKIIETKMLMGEVMREAAFSLAEAKFTAGDF-TTVIQNVNKAQVKIRAKKDN
VA-VTLPVFEHNHEGTD-YELTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRRVNAIEH-IIPRIERTLAYIITELDEREREEFY
-LKKIQEKKKILKEKSEKDLEQRRAAGEAMEPANLLAEEKDEDLLFE*