Sequences
EST Library Info
che1Heart - RNA from China
eje1Foetus 50 days, jejunum
rec1Rectum
sin1Small intestine
ute3Uterus
Clusters
Oligos
SNPs

Gene ID ENSG00000100558 (click for geneview)
Transcript ID ENST00000216446(link to ensembl)
Symbol PLEK2
Localtion Chromosome:14:66923458:66948614:-1 band: 14q23.3
Description Pleckstrin 2. [Source:Uniprot/SWISSPROT;Acc:Q9NYT0]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<----------------------------------------><---------------------------------------------------------
-M--E--D--G--V--L--K--E--G--F--L--V--K--R--G--H--I--V--H--N--W--K--A--R--W--F--I--L--R--Q--N--T--L--
ATGGAGGACGGCGTGCTCAAGGAGGGCTTCCTGGTCAAGAGGGGCCACATTGTCCACAACTGGAAGGCGCGATGGTTCATCCTTCGGCAGAACACGCTGG
:::::::::::::::::::::::::::::::: :::::::::::.::::::::::::::::::::::.::: ::::::::::::::::::::::::::: 
ATGGAGGACGGCGTGCTCAAGGAGGGCTTCCTCGTCAAGAGGGGTCACATTGTCCACAACTGGAAGGTGCGTTGGTTCATCCTTCGGCAGAACACGCTGC
-M--E--D--G--V--L--K--E--G--F--L--V--K--R--G--H--I--V--H--N--W--K--V--R--W--F--I--L--R--Q--N--T--L--

----------------------------------------------------------------------------------------------------
V--Y--Y--K--L--E--G--G--R--R--V--T--P--P--K--G--R--I--L--L--D--G--C--T--I--T--C--P--C--L--E--Y--E--N
TGTACTACAAGCTTGAGGGGGGTCGGAGAGTGACCCCTCCCAAGGGCCGGATCCTCCTGGATGGCTGCACCATCACCTGCCCCTGCCTGGAGTATGAAAA
:::::::.:::::.:::: ::::::::.::::: :::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::.:::::
TGTACTATAAGCTCGAGGCGGGTCGGAAAGTGAACCCTCCCAAGGGCCGGATCCTTCTGGATGGCTGCACCATCACCTGCCCCTGCCTGGAGTACGAAAA
L--Y--Y--K--L--E--A--G--R--K--V--N--P--P--K--G--R--I--L--L--D--G--C--T--I--T--C--P--C--L--E--Y--E--N

------><--------------------------------------------------------------------------------------------
--R--P--L--L--I--K--L--K--T--Q--T--S--T--E-----Y--F--L--E--A--C--S--R--E--E--R--D--A--W--A--F--E--I-
CCGACCGCTCCTCATTAAGCTGAAGACTCAAACATCCACGGAG---TACTTCCTGGAGGCCTGTTCTCGAGAGGAGCGGGATGCCTGGGCCTTTGAGATC
::::::::: ::::::::::::::.:: ::.:::::.::.:.    :::::::::::::::::::::::::::::: :::::::::::::::::::::: 
CCGACCGCTGCTCATTAAGCTGAAAACGCAGACATCTACAGGNG--TACTTCCTGGAGGCCTGTTCTCGAGAGGAGAGGGATGCCTGGGCCTTTGAGATA
--R--P--L--L--I--K--L--K--T--Q--T--S--T--X--\--Y--F--L--E--A--C--S--R--E--E--R--D--A--W--A--F--E--I-

-------------------------------------------------------------------------------------------><-------
-T--G--A--I--H--A--G--Q--P--G--K--V--Q--Q--L--H--S--L--R--N--S--F--K--L--P--P--H--I--S--L--H--R--I--
ACCGGGGCTATTCATGCAGGGCAGCCGGGGAAGGTCCAGCAGCTGCACAGCCTGAGAAACTCCTTCAAGCTGCCCCCGCACATCAGCCTGCATCGCATTG
:: ::.::::::::.:: :::::::: ::::::::::::::.:: ::::  .:::.::::::::::::::::::::: ::::::::::::   :::::..
ACAGGAGCTATTCACGCTGGGCAGCCCGGGAAGGTCCAGCAACTCCACATATTGAAAAACTCCTTCAAGCTGCCCCCTCACATCAGCCTG---CGCATCA
-T--G--A--I--H--A--G--Q--P--G--K--V--Q--Q--L--H--I--L--K--N--S--F--K--L--P--P--H--I--S--L-----R--I--

-----------------------------------------------------------------------------------><---------------
V--D--K--M--H--D--S--N--T--G--I--R--S--S--P--N--M--E--Q--G--S--T--Y--K--K--T--F--L--G--S--S--L--V--D
TGGACAAGATGCACGATAGCAACACCGGAATCCGTTCAAGCCCCAACATGGAGCAGGGAAGCACCTATAAAAAGACCTTCCTCGGCTCCTCCCTGGTGGA
:.:::::::::::.::.::::.:: .:::::::: .:::::::::::::::::::::::::::::::.::::::::::::      :::::::: :::::
TAGACAAGATGCATGACAGCAGCAGTGGAATCCGGCCAAGCCCCAACATGGAGCAGGGAAGCACCTACAAAAAGACCTTC------TCCTCCCTCGTGGA
I--D--K--M--H--D--S--S--S--G--I--R--P--S--P--N--M--E--Q--G--S--T--Y--K--K--T--F--------S--S--L--V--D

----------------------------------------------------------------------------------------------------
--W--L--I--S--N--S--F--T--A--S--R--L--E--A--V--T--L--A--S--M--L--M--E--E--N--F--L--R--P--V--G--V--R-
CTGGCTCATCTCCAACAGCTTCACGGCCAGCCGTCTGGAGGCGGTGACCCTGGCCTCCATGCTCATGGAGGAGAACTTCCTCAGGCCTGTGGGTGTCCGA
::::::::::::::::::::::.:.:::::::::::::::::.::::::.:::::::::::::::::::::::::.:::::.::::: :::::.:.::::
CTGGCTCATCTCCAACAGCTTCGCAGCCAGCCGTCTGGAGGCAGTGACCTTGGCCTCCATGCTCATGGAGGAGAATTTCCTTAGGCCGGTGGGCGCCCGA
--W--L--I--S--N--S--F--A--A--S--R--L--E--A--V--T--L--A--S--M--L--M--E--E--N--F--L--R--P--V--G--A--R-

-----------------------------------------------------------------------><---------------------------
-S--M--G--A--I--R--S--G--D--L--A--E--Q--F--L--D--D--S--T--A--L--Y--T--F--A--E--S--Y--K--K--K--I--S--
AGCATGGGAGCCATTCGCTCTGGGGATCTGGCCGAGCAGTTCCTGGATGACTCCACAGCCCTGTACACTTTTGCTGAGAGCTACAAAAAGAAGATAAGCC
::::..:::::::::::::::::::::::::..::::::::.::::::::::::::.:::::::::::::::   :::::::.:::.::.::::::::::
AGCACAGGAGCCATTCGCTCTGGGGATCTGGTTGAGCAGTTTCTGGATGACTCCACGGCCCTGTACACTTTT---GAGAGCTGCAAGAAAAAGATAAGCC
-S--T--G--A--I--R--S--G--D--L--V--E--Q--F--L--D--D--S--T--A--L--Y--T--F-----E--S--C--K--K--K--I--S--

-------------------------------------------------------------------------><-------------------------
P--K--E--E--I--S--L--S--T--V--E--L--S--G--T--V--V--K--Q--G--Y--L--A--K--Q--G--H--K--R--K--N--W--K--V
CCAAGGAAGAAATTAGCCTGAGCACTGTGGAGTTAAGTGGCACGGTGGTGAAACAAGGCTACCTGGCCAAGCAGGGACACAAGAGGAAAAACTGGAAGGT
::::::::::::: ::.:: :::::::::::::::::::: ::.:::::::::::::::::.::::::::.:::::.:::::::::::::::::::::::
CCAAGGAAGAAATAAGTCTCAGCACTGTGGAGTTAAGTGGAACAGTGGTGAAACAAGGCTATCTGGCCAAACAGGGGCACAAGAGGAAAAACTGGAAGGT
P--K--E--E--I--S--L--S--T--V--E--L--S--G--T--V--V--K--Q--G--Y--L--A--K--Q--G--H--K--R--K--N--W--K--V

---------------------------------------------------------><-----------------------------------------
--R--R--F--V--L--R--K--D--P--A--F--L--H--Y--Y--D--P--S--K--E--E--N--R--P--V--G--G--F--S--L--R--G--S-
GCGTCGCTTTGTTCTAAGGAAGGATCCAGCTTTCCTGCATTACTATGACCCTTCCAAAGAAGAGAACAGGCCAGTGGGTGGGTTTTCTCTTCGTGGTTCA
::: :::::.::: ::::::::::.::.:::::::::::::::::.::::::::::::::::::::: :::: :::::::::::::::::.:::::::::
GCGGCGCTTCGTTATAAGGAAGGACCCGGCTTTCCTGCATTACTACGACCCTTCCAAAGAAGAGAACCGGCCTGTGGGTGGGTTTTCTCTCCGTGGTTCA
--R--R--F--V--I--R--K--D--P--A--F--L--H--Y--Y--D--P--S--K--E--E--N--R--P--V--G--G--F--S--L--R--G--S-

------------------------------------><--------------------------------------------------------------
-L--V--S--A--L--E--D--N--G--V--P--T--G--V--K--G--N--V--Q--G--N--L--F--K--V--I--T--K--D--D--T--H--Y--
CTCGTGTCTGCTCTGGAAGATAATGGCGTTCCCACTGGGGTTAAAGGGAATGTCCAGGGAAACCTCTTCAAAGTGATTACTAAGGATGACACACACTATT
::::::::::: :::::.:::::.::::::::::::   :::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::
CTCGTGTCTGCGCTGGAGGATAACGGCGTTCCCACT---GTTAAAGGGAATGTCCAGGGAAATCTCTTCAAAGTGATTACTAAGGATGACACACACTATT
-L--V--S--A--L--E--D--N--G--V--P--T-----V--K--G--N--V--Q--G--N--L--F--K--V--I--T--K--D--D--T--H--Y--

---------------------------------------------------------------->
Y--I--Q--A--S--S--K--A--E--R--A--E--W--I--E--A--I--K--K--L--T--*-
ACATTCAGGCCAGCAGCAAGGCTGAGCGAGCCGAGTGGATTGAAGCTATCAAAAAGCTAACATGA
:.::.:::::::::::::::::::::::  : ::::::::.:::::::::::: :::::::.:::
ATATCCAGGCCAGCAGCAAGGCTGAGCGTTCAGAGTGGATCGAAGCTATCAAACAGCTAACGTGA
Y--I--Q--A--S--S--K--A--E--R--S--E--W--I--E--A--I--K--Q--L--T--*-

Pig Consensus Sequence

>BGISUST0000882556
ATGGAGGACGGCGTGCTCAAGGAGGGCTTCCTCGTCAAGAGGGGTCACATTGTCCACAACTGGAAGGTGCGTTGGTTCATCCTTCGGCAGAACACGCTGC
TGTACTATAAGCTCGAGGCGGGTCGGAAAGTGAACCCTCCCAAGGGCCGGATCCTTCTGGATGGCTGCACCATCACCTGCCCCTGCCTGGAGTACGAAAA
CCGACCGCTGCTCATTAAGCTGAAAACGCAGACATCTACAGGntACTTCCTGGAGGCCTGTTCTCGAGAGGAGAGGGATGCCTGGGCCTTTGAGATAACA
GGAGCTATTCACGCTGGGCAGCCCGGGAAGGTCCAGCAACTCCACATATTGAAAAACTCCTTCAAGCTGCCCCCTCACATCAGCCTG---CGCATCATAG
ACAAGATGCATGACAGCAGCAGTGGAATCCGGCCAAGCCCCAACATGGAGCAGGGAAGCACCTACAAAAAGACCTTC------TCCTCCCTCGTGGACTG
GCTCATCTCCAACAGCTTCGCAGCCAGCCGTCTGGAGGCAGTGACCTTGGCCTCCATGCTCATGGAGGAGAATTTCCTTAGGCCGGTGGGCGCCCGAAGC
ACAGGAGCCATTCGCTCTGGGGATCTGGTTGAGCAGTTTCTGGATGACTCCACGGCCCTGTACACTTTT---GAGAGCTGCAAGAAAAAGATAAGCCCCA
AGGAAGAAATAAGTCTCAGCACTGTGGAGTTAAGTGGAACAGTGGTGAAACAAGGCTATCTGGCCAAACAGGGGCACAAGAGGAAAAACTGGAAGGTGCG
GCGCTTCGTTATAAGGAAGGACCCGGCTTTCCTGCATTACTACGACCCTTCCAAAGAAGAGAACCGGCCTGTGGGTGGGTTTTCTCTCCGTGGTTCACTC
GTGTCTGCGCTGGAGGATAACGGCGTTCCCACT---GTTAAAGGGAATGTCCAGGGAAATCTCTTCAAAGTGATTACTAAGGATGACACACACTATTATA
TCCAGGCCAGCAGCAAGGCTGAGCGTTCAGAGTGGATCGAAGCTATCAAACAGCTAACGTGA


>BGISUSP0000882556
MEDGVLKEGFLVKRGHIVHNWKVRWFILRQNTLLYYKLEAGRKVNPPKGRILLDGCTITCPCLEYENRPLLIKLKTQTST-YFLEACSREERDAWAFEIT
GAIHAGQPGKVQQLHILKNSFKLPPHISL-RIIDKMHDSSSGIRPSPNMEQGSTYKKTF--SSLVDWLISNSFAASRLEAVTLASMLMEENFLRPVGARS
TGAIRSGDLVEQFLDDSTALYTF-ESCKKKISPKEEISLSTVELSGTVVKQGYLAKQGHKRKNWKVRRFVIRKDPAFLHYYDPSKEENRPVGGFSLRGSL
VSALEDNGVPT-VKGNVQGNLFKVITKDDTHYYIQASSKAERSEWIEAIKQLT*