Sequences
EST Library Info
plac1Unavailable
spl2Spleen
ton2Tip of tongue, mucosal membrane
Clusters
Oligos
SNPs

Gene ID ENSG00000100596 (click for geneview)
Transcript ID ENST00000216484(link to ensembl)
Symbol SPTLC2
Localtion Chromosome:14:77043025:77152863:-1 band: 14q24.3
Description Serine palmitoyltransferase 2 (EC 2.3.1.50) (Long chain base biosynthesis protein 2) (LCB 2) (Serine-palmitoyl-CoA transferase 2) (SPT 2). [Source:Uniprot/SWISSPROT;Acc:O15270]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--R--P--E--P--G--G--C--C--C--R--R--T--V--R--A--N--G--C--V--A--N--G--E--V--R--N--G--Y--V--R--S--S--
ATGCGGCCGGAGCCCGGAGGCTGCTGCTGCCGCCGCACGGTGCGGGCGAATGGCTGCGTGGCGAACGGGGAAGTACGGAACGGGTACGTGAGGAGCAGCG
::::::.:::. ::::.::::   ::::::::.::: :::::::::::::.::::::::::::::::::::.::.:::::::::::::::::::::::::
ATGCGGTCGGGTCCCGAAGGC---TGCTGCCGTCGCCCGGTGCGGGCGAACGGCTGCGTGGCGAACGGGGAGGTGCGGAACGGGTACGTGAGGAGCAGCG
-M--R--S--G--P--E--G-----C--C--R--R--P--V--R--A--N--G--C--V--A--N--G--E--V--R--N--G--Y--V--R--S--S--

-------------------------------><-------------------------------------------------------------------
A--A--A--A--A--A--A--A--A--G--Q--I--H--H--V--T--Q--N--G--G--L--Y--K--R--P--F--N--E--A--F--E--E--T--P
CTGCAGCCGCAGCCGCAGCCGCCGCCGGCCAGATCCATCATGTTACACAAAATGGAGGACTATATAAAAGACCGTTTAATGAAGCTTTTGAAGAAACACC
:.:: ::::: :: :: ::.:::                                                                             
CCGCTGCCGCCGCAGCCGCTGCC-----------------------------------------------------------------------------
A--A--A--A--A--A--A--A------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--M--L--V--A--V--L--T--Y--V--G--Y--G--V--L--T--L--F--G--Y--L--R--D--F--L--R--Y--W--R--I--E--K--C--H-
AATGCTGGTTGCTGTGCTCACGTATGTGGGGTATGGCGTACTCACCCTCTTTGGATATCTTCGAGATTTCTTGAGGTATTGGAGAATTGAAAAGTGTCAC
          ::::::::.:: ::::: ::::::::.::::::::.::::::::::::::::::::::::::::::.:::::::::::::::::::::::
----------GCTGTGCTTACTTATGTCGGGTATGGTGTACTCACTCTCTTTGGATATCTTCGAGATTTCTTGAGGCATTGGAGAATTGAAAAGTGTCAC
-----------A--V--L--T--Y--V--G--Y--G--V--L--T--L--F--G--Y--L--R--D--F--L--R--H--W--R--I--E--K--C--H-

--------------------------><------------------------------------------------------------------------
-H--A--T--E--R--E--E--Q--K--D--F--V--S--L--Y--Q--D--F--E--N--F--Y--T--R--N--L--Y--M--R--I--R--D--N--
CATGCAACAGAAAGAGAAGAACAAAAGGACTTTGTGTCATTGTATCAAGATTTTGAAAACTTTTATACAAGGAATCTGTACATGAGGATAAGAGACAACT
::::::::.::::::::::::::: ::::::::::::::::::::::.::::::::::::::.:::::::::::.:: ::.::::::::  :::::::::
CATGCAACGGAAAGAGAAGAACAACAGGACTTTGTGTCATTGTATCAGGATTTTGAAAACTTCTATACAAGGAACCTCTATATGAGGATTCGAGACAACT
-H--A--T--E--R--E--E--Q--Q--D--F--V--S--L--Y--Q--D--F--E--N--F--Y--T--R--N--L--Y--M--R--I--R--D--N--

---------------------------------------------------------------------------------><-----------------
W--N--R--P--I--C--S--V--P--G--A--R--V--D--I--M--E--R--Q--S--H--D--Y--N--W--S--F--K--Y--T--G--N--I--I
GGAATCGGCCAATCTGTAGTGTGCCTGGAGCCAGGGTGGACATCATGGAGAGACAGTCTCATGATTATAACTGGTCCTTCAAGTATACAGGGAATATAAT
:::::::.:: :::::.::::::::::::::::::::::::::::::::::::::::::::.::.::.:::::::: :::   ::.:: :::::::::::
GGAATCGACCCATCTGCAGTGTGCCTGGAGCCAGGGTGGACATCATGGAGAGACAGTCTCACGACTACAACTGGTCATTC---TACACCGGGAATATAAT
W--N--R--P--I--C--S--V--P--G--A--R--V--D--I--M--E--R--Q--S--H--D--Y--N--W--S--F-----Y--T--G--N--I--I

----------------------------------------------------------------------------------------------------
--K--G--V--I--N--M--G--S--Y--N--Y--L--G--F--A--R--N--T--G--S--C--Q--E--A--A--A--K--V--L--E--E--Y--G-
AAAGGGTGTTATAAACATGGGTTCCTACAACTATCTTGGATTTGCACGGAATACTGGATCATGTCAAGAAGCAGCCGCCAAAGTCCTTGAGGAGTATGGA
 ::.:.::::::::::::::::::::::::.:::::::::::::::::.::::::::: ::::::::::.:::::.::::::::::: ::::::::::: 
TAAAGATGTTATAAACATGGGTTCCTACAATTATCTTGGATTTGCACGAAATACTGGAGCATGTCAAGAGGCAGCTGCCAAAGTCCTGGAGGAGTATGGT
--K--D--V--I--N--M--G--S--Y--N--Y--L--G--F--A--R--N--T--G--A--C--Q--E--A--A--A--K--V--L--E--E--Y--G-

------------------------------><--------------------------------------------------------------------
-A--G--V--C--S--T--R--Q--E--I--G--N--L--D--K--H--E--E--L--E--E--L--V--A--R--F--L--G--V--E--A--A--M--
GCTGGAGTGTGCAGTACTCGGCAGGAAATTGGAAACCTGGACAAGCATGAAGAACTAGAGGAGCTTGTAGCAAGGTTCTTAGGAGTAGAAGCTGCTATGG
:.::::::::::::.:::::::::::::::   :::::::::::::::::::::::::::.:::::::.::::: :::::.:::::::::::::::::::
GTTGGAGTGTGCAGCACTCGGCAGGAAATT---AACCTGGACAAGCATGAAGAACTAGAGAAGCTTGTGGCAAGTTTCTTGGGAGTAGAAGCTGCTATGG
-V--G--V--C--S--T--R--Q--E--I-----N--L--D--K--H--E--E--L--E--K--L--V--A--S--F--L--G--V--E--A--A--M--

-------------------------------------------------------><-------------------------------------------
A--Y--G--M--G--F--A--T--N--S--M--N--I--P--A--L--V--G--K--G--C--L--I--L--S--D--E--L--N--H--A--S--L--V
CGTATGGCATGGGATTTGCAACGAATTCAATGAACATTCCTGCTCTTGTTGGCAAAGGTTGCCTGATTCTGAGTGATGAACTGAATCATGCATCACTGGT
:.:::::::::::.::::::::.:::::::::::::::::::::::::::.:::::::::::::.:::::::::::::::::.::.:::::.::::::::
CATATGGCATGGGGTTTGCAACAAATTCAATGAACATTCCTGCTCTTGTTAGCAAAGGTTGCCTAATTCTGAGTGATGAACTAAACCATGCGTCACTGGT
A--Y--G--M--G--F--A--T--N--S--M--N--I--P--A--L--V--S--K--G--C--L--I--L--S--D--E--L--N--H--A--S--L--V

-------------------------------------------------><-------------------------------------------------
--L--G--A--R--L--S--G--A--T--I--R--I--F--K--H--N--N--M--Q--S--L--E--K--L--L--K--D--A--I--V--Y--G--Q-
TCTGGGAGCCAGACTGTCAGGAGCAACCATTAGAATCTTCAAACACAACAATATGCAAAGCCTAGAGAAGCTATTGAAAGATGCCATTGTTTATGGTCAG
::::::::::::::: ::::::::::::::: :::::::::::::::::   ::::::::::::::::::::.:::::.:::::::::::::::::::::
TCTGGGAGCCAGACTCTCAGGAGCAACCATTCGAATCTTCAAACACAAC---ATGCAAAGCCTAGAGAAGCTGTTGAAGGATGCCATTGTTTATGGTCAG
--L--G--A--R--L--S--G--A--T--I--R--I--F--K--H--N-----M--Q--S--L--E--K--L--L--K--D--A--I--V--Y--G--Q-

-------------------------------------------------------><-------------------------------------------
-P--R--T--R--R--P--W--K--K--I--L--I--L--V--E--G--I--Y--S--M--E--G--S--I--V--R--L--P--E--V--I--A--L--
CCTCGGACACGAAGGCCCTGGAAGAAAATTCTCATCCTTGTGGAAGGAATATATAGCATGGAGGGATCTATTGTTCGTCTTCCTGAAGTGATTGCCCTCA
::::::::::::::::::::.::::::::::: :::::::::::.:::::::::   ::::::::::::::::::::.::::::::::::::::::::.:
CCTCGGACACGAAGGCCCTGAAAGAAAATTCTAATCCTTGTGGAGGGAATATAT---ATGGAGGGATCTATTGTTCGCCTTCCTGAAGTGATTGCCCTTA
-P--R--T--R--R--P--*--K--K--I--L--I--L--V--E--G--I--Y-----M--E--G--S--I--V--R--L--P--E--V--I--A--L--

----------------------------------------------------------------------------------------------------
K--K--K--Y--K--A--Y--L--Y--L--D--E--A--H--S--I--G--A--L--G--P--T--G--R--G--V--V--E--Y--F--G--L--D--P
AGAAGAAATACAAGGCATACTTGTATCTGGATGAGGCTCACAGCATTGGCGCCCTGGGCCCCACAGGCCGGGGTGTGGTGGAGTACTTTGGCCTGGATCC
::::::::::::::::::::::::::::.:::::.:::::::::::::: ::.::::::::::::::.::.::::::::::: :::::.:::::::::::
AGAAGAAATACAAGGCATACTTGTATCTAGATGAAGCTCACAGCATTGGGGCTCTGGGCCCCACAGGTCGAGGTGTGGTGGACTACTTCGGCCTGGATCC
K--K--K--Y--K--A--Y--L--Y--L--D--E--A--H--S--I--G--A--L--G--P--T--G--R--G--V--V--D--Y--F--G--L--D--P

---------------------------------------------------------------------------><-----------------------
--E--D--V--D--V--M--M--G--T--F--T--K--S--F--G--A--S--G--G--Y--I--G--G--K--K--E--L--I--D--Y--L--R--T-
CGAGGATGTGGATGTTATGATGGGAACGTTCACAAAGAGTTTTGGTGCTTCTGGAGGATATATTGGAGGCAAGAAGGAGCTGATAGACTACCTGCGAACA
.:::::.:::::..:::::::::::::.::.::::::::.::::::::::::::::::::.::::::::::::::::::::::: :::::.:::::.:::
TGAGGACGTGGACATTATGATGGGAACATTTACAAAGAGCTTTGGTGCTTCTGGAGGATACATTGGAGGCAAGAAGGAGCTGATTGACTATCTGCGGACA
--E--D--V--D--I--M--M--G--T--F--T--K--S--F--G--A--S--G--G--Y--I--G--G--K--K--E--L--I--D--Y--L--R--T-

----------------------------------------------------------------------------------------------------
-H--S--H--S--A--V--Y--A--T--S--L--S--P--P--V--V--E--Q--I--I--T--S--M--K--C--I--M--G--Q--D--G--T--S--
CATTCTCATAGTGCAGTGTATGCCACGTCATTGTCACCTCCTGTAGTGGAGCAGATCATCACCTCCATGAAGTGCATCATGGGGCAGGATGGCACCAGCC
::::::::.::::: :::::.::::::::..::::.:: ::::: ::::::::::::::::::::.::::::::::::::::::::::::::::::: ::
CATTCTCACAGTGCCGTGTACGCCACGTCGCTGTCGCCACCTGTCGTGGAGCAGATCATCACCTCTATGAAGTGCATCATGGGGCAGGATGGCACCACCC
-H--S--H--S--A--V--Y--A--T--S--L--S--P--P--V--V--E--Q--I--I--T--S--M--K--C--I--M--G--Q--D--G--T--T--

--><------------------------------------------------------------------------------------------------
L--G--K--E--C--V--Q--Q--L--A--E--N--T--R--Y--F--R--R--R--L--K--E--M--G--F--I--I--Y--G--N--E--D--S--P
TTGGTAAAGAGTGTGTACAACAGTTAGCTGAAAACACCAGGTATTTCAGGAGACGCCTGAAAGAGATGGGCTTCATCATCTATGGAAATGAAGACTCTCC
::   :::::.:::.::::.::::::::.::::::::::::::::::::::::::.::.:::::::::::::::::::::::::::::::::::.:::::
TT---AAAGAATGTATACAGCAGTTAGCCGAAAACACCAGGTATTTCAGGAGACGTCTAAAAGAGATGGGCTTCATCATCTATGGAAATGAAGATTCTCC
L-----K--E--C--I--Q--Q--L--A--E--N--T--R--Y--F--R--R--R--L--K--E--M--G--F--I--I--Y--G--N--E--D--S--P

--------------------------------------><------------------------------------------------------------
--V--V--P--L--M--L--Y--M--P--A--K--I--G--A--F--G--R--E--M--L--K--R--N--I--G--V--V--V--V--G--F--P--A-
AGTAGTGCCTTTGATGCTCTACATGCCTGCCAAAATTGGCGCCTTTGGACGGGAGATGCTGAAGCGGAACATCGGTGTCGTTGTGGTTGGATTTCCTGCC
::: ::::::.:::::::::::::::: :::::::::   ::::::::.:::::::::::.::::::::..:::::::::::::::: :::::::::::.
AGTTGTGCCTCTGATGCTCTACATGCCGGCCAAAATT---GCCTTTGGGCGGGAGATGCTAAAGCGGAATGTCGGTGTCGTTGTGGTAGGATTTCCTGCT
--V--V--P--L--M--L--Y--M--P--A--K--I-----A--F--G--R--E--M--L--K--R--N--V--G--V--V--V--V--G--F--P--A-

--------------------------------------------------------------------><------------------------------
-T--P--I--I--E--S--R--A--R--F--C--L--S--A--A--H--T--K--E--I--L--D--T--A--L--K--E--I--D--E--V--G--D--
ACCCCAATTATTGAGTCCAGAGCCAGGTTTTGCCTGTCAGCAGCTCATACCAAAGAAATACTTGATACTGCTTTAAAGGAGATAGATGAAGTTGGGGACC
::::::::.::.::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::
ACCCCAATCATCGAGTCCAGAGCCAGGTTTTGCCTGTCGGCAGCTCATACCAAAGAAATACTTGATACTGCTTTAAAGGAGATAGATGAAGTCGGGGACC
-T--P--I--I--E--S--R--A--R--F--C--L--S--A--A--H--T--K--E--I--L--D--T--A--L--K--E--I--D--E--V--G--D--

---------------------------------------------------------------------------------------->
L--L--Q--L--K--Y--S--R--H--R--L--V--P--L--L--D--R--P--F--D--E--T--T--Y--E--E--T--E--D--*-
TATTGCAGCTGAAGTATTCCCGTCATCGGTTGGTACCTCTACTGGACAGGCCCTTTGACGAGACGACGTATGAAGAAACAGAAGACTGA
:.:::::::::::::::::::::::::::::::::::.:::                                                
TGTTGCAGCTGAAGTATTCCCGTCATCGGTTGGTACCCCTA------------------------------------------------
L--L--Q--L--K--Y--S--R--H--R--L--V--P--L-------------------------------------------------

Pig Consensus Sequence

>BGISUST0000895150
ATGCGGTCGGGTCCCGAAGGCTGCTGCCGTCGCCCGGTGCGGGCGAACGGCTGCGTGGCGAACGGGGAGGTGCGGAACGGGTACGTGAGGAGCAGCGCCG
CTGCCGCCGCAGCCGCTGCC--------------------------------------------------------------------------------
-------GCTGTGCTTACTTATGTCGGGTATGGTGTACTCACTCTCTTTGGATATCTTCGAGATTTCTTGAGGCATTGGAGAATTGAAAAGTGTCACCAT
GCAACGGAAAGAGAAGAACAACAGGACTTTGTGTCATTGTATCAGGATTTTGAAAACTTCTATACAAGGAACCTCTATATGAGGATTCGAGACAACTGGA
ATCGACCCATCTGCAGTGTGCCTGGAGCCAGGGTGGACATCATGGAGAGACAGTCTCACGACTACAACTGGTCATTC---TACACCGGGAATATAATTAA
AGATGTTATAAACATGGGTTCCTACAATTATCTTGGATTTGCACGAAATACTGGAGCATGTCAAGAGGCAGCTGCCAAAGTCCTGGAGGAGTATGGTGTT
GGAGTGTGCAGCACTCGGCAGGAAATT---AACCTGGACAAGCATGAAGAACTAGAGAAGCTTGTGGCAAGTTTCTTGGGAGTAGAAGCTGCTATGGCAT
ATGGCATGGGGTTTGCAACAAATTCAATGAACATTCCTGCTCTTGTTAGCAAAGGTTGCCTAATTCTGAGTGATGAACTAAACCATGCGTCACTGGTTCT
GGGAGCCAGACTCTCAGGAGCAACCATTCGAATCTTCAAACACAAC---ATGCAAAGCCTAGAGAAGCTGTTGAAGGATGCCATTGTTTATGGTCAGCCT
CGGACACGAAGGCCCTGAAAGAAAATTCTAATCCTTGTGGAGGGAATATAT---ATGGAGGGATCTATTGTTCGCCTTCCTGAAGTGATTGCCCTTAAGA
AGAAATACAAGGCATACTTGTATCTAGATGAAGCTCACAGCATTGGGGCTCTGGGCCCCACAGGTCGAGGTGTGGTGGACTACTTCGGCCTGGATCCTGA
GGACGTGGACATTATGATGGGAACATTTACAAAGAGCTTTGGTGCTTCTGGAGGATACATTGGAGGCAAGAAGGAGCTGATTGACTATCTGCGGACACAT
TCTCACAGTGCCGTGTACGCCACGTCGCTGTCGCCACCTGTCGTGGAGCAGATCATCACCTCTATGAAGTGCATCATGGGGCAGGATGGCACCACCCTT-
--AAAGAATGTATACAGCAGTTAGCCGAAAACACCAGGTATTTCAGGAGACGTCTAAAAGAGATGGGCTTCATCATCTATGGAAATGAAGATTCTCCAGT
TGTGCCTCTGATGCTCTACATGCCGGCCAAAATT---GCCTTTGGGCGGGAGATGCTAAAGCGGAATGTCGGTGTCGTTGTGGTAGGATTTCCTGCTACC
CCAATCATCGAGTCCAGAGCCAGGTTTTGCCTGTCGGCAGCTCATACCAAAGAAATACTTGATACTGCTTTAAAGGAGATAGATGAAGTCGGGGACCTGT
TGCAGCTGAAGTATTCCCGTCATCGGTTGGTACCCCTA------------------------------------------------


>BGISUSP0000895150
MRSGPEGCCRRPVRANGCVANGEVRNGYVRSSAAAAAAAA-----------------------------AVLTYVGYGVLTLFGYLRDFLRHWRIEKCHH
ATEREEQQDFVSLYQDFENFYTRNLYMRIRDNWNRPICSVPGARVDIMERQSHDYNWSF-YTGNIIKDVINMGSYNYLGFARNTGACQEAAAKVLEEYGV
GVCSTRQEI-NLDKHEELEKLVASFLGVEAAMAYGMGFATNSMNIPALVSKGCLILSDELNHASLVLGARLSGATIRIFKHN-MQSLEKLLKDAIVYGQP
RTRRP*KKILILVEGIY-MEGSIVRLPEVIALKKKYKAYLYLDEAHSIGALGPTGRGVVDYFGLDPEDVDIMMGTFTKSFGASGGYIGGKKELIDYLRTH
SHSAVYATSLSPPVVEQIITSMKCIMGQDGTTL-KECIQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKI-AFGREMLKRNVGVVVVGFPAT
PIIESRARFCLSAAHTKEILDTALKEIDEVGDLLQLKYSRHRLVPL----------------