Sequences
EST Library Info
nbm2Newborn 115 days, bone marrow (pelvis)
Clusters
Oligos
SNPs

Gene ID ENSG00000100629 (click for geneview)
Transcript ID ENST00000216517(link to ensembl)
Symbol Q86X97_HUMAN
Localtion Chromosome:14:80366260:80477784:-1 band: 14q31.1
Description PREDICTED: chromosome 14 open reading frame 61
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<----------------------------------------------------><---------------------------------------------
-M--L--G--R--Y--R--E--Y--S--N--G--Q--A--G--A--I--E--H--L--K--E--S--L--E--Q--S--I--D--Q--L--R--S--Q--
ATGCTTGGACGATACCGAGAATACAGTAATGGACAGGCGGGTGCGATAGAACATTTAAAAGAAAGCTTGGAACAATCAATCGACCAACTCCGGAGTCAAC
::::::::::..::.::::::::.:::::::::::::::::::: :::::: :::::::::::::::::::::::::::: :.::::::.::::::::.:
ATGCTTGGACAGTATCGAGAATATAGTAATGGACAGGCGGGTGCTATAGAAAATTTAAAAGAAAGCTTGGAACAATCAATAGGCCAACTTCGGAGTCAGC
-M--L--G--Q--Y--R--E--Y--S--N--G--Q--A--G--A--I--E--N--L--K--E--S--L--E--Q--S--I--G--Q--L--R--S--Q--

-----------------------------------------------------------------------------------><---------------
R--L--L--R--N--S--G--G--R-----S--I--S--V--T--S--L--S--A--S--D--L--D--G--G--T--G--S--E--L--H--H--F--P
GTTTATTGAGAAACTCAGGAGGGAGA---AGTATTTCTGTTACAAGTTTGAGTGCAAGTGACCTTGATGGTGGCACTGGGTCAGAGCTCCATCATTTTCC
::::::.:::::::::::::::::::   ::::::::::::::::::.:::::.::::::::::.::.:::::::::           :::.:..:::::
GTTTATCGAGAAACTCAGGAGGGAGAAGAAGTATTTCTGTTACAAGTCTGAGTACAAGTGACCTCGACGGTGGCACT---------AGCCACCGCTTTCC
R--L--S--R--N--S--G--G--R--R--S--I--S--V--T--S--L--S--T--S--D--L--D--G--G--T-----------S--H--R--F--P

----------------------------------------------------------------------------------------------------
--P--T--S--P--L--K--D--Y--G--D--P--Q--G--I--K--R--M--R--S--R--T--G--V--R--F--V--Q--E--T--D--D--M--T-
ACCTACCTCACCTCTCAAGGACTATGGGGATCCACAGGGTATTAAACGAATGAGATCAAGAACTGGTGTCCGGTTTGTTCAAGAGACTGATGATATGACT
::::::::::::::: :::::::::::::::: ::::::.:::::: :::  ::.:: :::::.::::::::.::::::::.:::::::::::.:::. .
ACCTACCTCACCTCTAAAGGACTATGGGGATCAACAGGGCATTAAAAGAAATAGGTCCAGAACCGGTGTCCGATTTGTTCAGGAGACTGATGACATGGGC
--P--T--S--P--L--K--D--Y--G--D--Q--Q--G--I--K--R--N--R--S--R--T--G--V--R--F--V--Q--E--T--D--D--M--G-

--><------------------------------------------------------------------------------------------><----
-Q--L--H--G--F--H--Q--S--L--R--D--L--S--S--E--Q--I--R--L--G--D--D--F--N--R--E--L--S--R--R--S--R--S--
CAGCTTCATGGTTTTCATCAGTCTCTTCGAGACCTCAGCAGTGAACAAATTCGCCTTGGAGATGATTTCAACAGGGAGCTTTCCAGAAGGAGCCGGTCAG
:::                                                                                             ::.:
CAG---------------------------------------------------------------------------------------------TCGG
-Q-----------------------------------------------------------------------------------------------S--

-------------------------------------------------------------------><-------------------------------
D--A--E--T--K--R--A--L--E--E--L--T--E--K--L--N--E--A--Q--K--Q--E--V--V--S--D--R--V--E--R--R--L--Q--E
ATGCCGAAACAAAAAGGGCTTTGGAAGAATTGACTGAAAAACTTAATGAAGCCCAGAAACAAGAAGTGGTTTCAGATCGGGTGGAGCGGCGGCTTCAGGA
::::.::::::::::::::::::::::::.::::.::::::::::::::::::::.:.: ::::::::::::::::::::::::::::.:::::::::::
ATGCTGAAACAAAAAGGGCTTTGGAAGAACTGACCGAAAAACTTAATGAAGCCCAAAGAAAAGAAGTGGTTTCAGATCGGGTGGAGCGACGGCTTCAGGA
D--A--E--T--K--R--A--L--E--E--L--T--E--K--L--N--E--A--Q--R--K--E--V--V--S--D--R--V--E--R--R--L--Q--E

------------------------------------------------------------------------------------><--------------
--L--E--R--E--M--R--T--E--R--E--L--V--E--R--R--Q--D--Q--L--G--L--M--S--L--Q--L--Q--E--A--L--K--K--Q-
ACTGGAGAGAGAGATGCGCACAGAAAGGGAGCTGGTGGAAAGACGCCAGGATCAACTGGGACTCATGTCCCTGCAGCTACAGGAGGCACTAAAGAAACAA
: :.::.:::::.:::::.::::::::.::: :::::::::::::.:::::::::::::::::.:: ::..:::::::::::::::::.:.:::::::::
AATAGAAAGAGAAATGCGTACAGAAAGAGAGGTGGTGGAAAGACGTCAGGATCAACTGGGACTTATTTCTTTGCAGCTACAGGAGGCATTGAAGAAACAA
--I--E--R--E--M--R--T--E--R--E--V--V--E--R--R--Q--D--Q--L--G--L--I--S--L--Q--L--Q--E--A--L--K--K--Q-

-----------------------------------------------------------------------><---------------------------
-E--A--K--A--D--E--H--E--G--A--I--K--N--K--L--R--Q--T--E--T--E--K--N--Q--L--E--Q--E--L--E--L--S--R--
GAAGCTAAAGCAGATGAGCATGAGGGGGCAATAAAAAATAAGCTAAGACAAACTGAAACTGAGAAGAATCAACTTGAACAGGAATTGGAGCTATCTCGAA
::::::::::: :::::: ::::::..:.:::.:::::::::::::::::.::::::::::::::::.: ::                            
GAAGCTAAAGCTGATGAGAATGAGGAAGTAATGAAAAATAAGCTAAGACAGACTGAAACTGAGAAGAGTAAA----------------------------
-E--A--K--A--D--E--N--E--E--V--M--K--N--K--L--R--Q--T--E--T--E--K--S--K-----------------------------

----------------------------------------------><----------------------------------------------------
R--L--L--N--Q--S--E--G--S--R--E--T--L--L--H--Q--V--E--E--L--R--T--Q--L--T--K--A--E--G--D--R--K--G--L
GGTTATTGAATCAATCAGAAGGCAGCCGAGAAACACTTTTGCATCAGGTAGAAGAACTGCGTACACAACTTACGAAAGCAGAAGGTGATCGAAAGGGTTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------------------------------------------><-------------------
--Q--H--Q--V--S--Q--I--S--K--Q--Q--S--N--Y--Q--D--E--Q--G--E--D--W--R--F--R--R--G--V--E--R--E--K--Q-
ACAGCATCAAGTATCTCAGATTTCCAAGCAACAGTCAAACTATCAGGATGAACAAGGGGAGGACTGGAGATTTAGGAGAGGGGTTGAGCGGGAAAAACAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-D--L--E--K--Q--M--S--D--L--R--V--Q--L--N--F--S--A--M--A--S--E--L--E--E--V--K--R--C--M--E--R--K--D--
GACCTGGAGAAGCAAATGTCAGATTTGAGAGTGCAGCTGAACTTCAGCGCAATGGCATCTGAGTTAGAGGAAGTGAAACGGTGCATGGAGAGAAAAGACA
                                                            :::::::::::::::::.:::::::::::: :::::::::
------------------------------------------------------------GAGTTAGAGGAAGTGAAGCGGTGCATGGAGCGAAAAGACA
-------------------------------------------------------------E--L--E--E--V--K--R--C--M--E--R--K--D--

-------------------------------><-------------------------------------------------------------------
K--E--K--A--H--L--A--S--Q--V--E--H--I--N--R--K--C--L--L--N--L--V--Q--D--L--D--C--K--D--N--E--I--L--T
AGGAGAAAGCACATTTGGCATCACAAGTAGAGCACATCAATAGAAAATGTCTTTTAAATTTGGTTCAAGATTTGGATTGTAAAGATAATGAAATATTGAC
::::::.::.:::::::::: :::::::::::                                                                    
AGGAGAGAGTACATTTGGCAGCACAAGTAGAG--------------------------------------------------------------------
K--E--R--V--H--L--A--A--Q--V--E---------------------------------------------------------------------

------------------------------>
--Y--S--L--Q--S--P--L--H--V--*-
ATACTCTTTACAAAGCCCTCTACATGTTTAA
                               
-------------------------------
-------------------------------

Pig Consensus Sequence

>BGISUST0000894543
ATGCTTGGACAGTATCGAGAATATAGTAATGGACAGGCGGGTGCTATAGAAAATTTAAAAGAAAGCTTGGAACAATCAATAGGCCAACTTCGGAGTCAGC
GTTTATCGAGAAACTCAGGAGGGAGAAGAAGTATTTCTGTTACAAGTCTGAGTACAAGTGACCTCGACGGTGGC---------AGCCACCGCTTTCCACC
TACCTCACCTCTAAAGGACTATGGGGATCAACAGGGCATTAAAAGAAATAGGTCCAGAACCGGTGTCCGATTTGTTCAGGAGACTGATGACATGGGCCAG
---------------------------------------------------------------------------------------------TCGGATG
CTGAAACAAAAAGGGCTTTGGAAGAACTGACCGAAAAACTTAATGAAGCCCAAAGAAAAGAAGTGGTTTCAGATCGGGTGGAGCGACGGCTTCAGGAAAT
AGAAAGAGAAATGCGTACAGAAAGAGAGGTGGTGGAAAGACGTCAGGATCAACTGGGACTTATTTCTTTGCAGCTACAGGAGGCATTGAAGAAACAAGAA
GCTAAAGCTGATGAGAATGAGGAAGTAATGAAAAATAAGCTAAGACAGACTGAAACTGAGAAGAGTAAA-------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------------------------------------------------GAGTTAGAGGAAGTGAAGCGGTGCATGGAGCGAAAAGACAAGG
AGAGAGTACATTTGGCAGCACAAGTAGAG-----------------------------------------------------------------------
----------------------------


>BGISUSP0000894543
MLGQYREYSNGQAGAIENLKESLEQSIGQLRSQRLSRNSGGRRSISVTSLSTSDLDGG---SHRFPPTSPLKDYGDQQGIKRNRSRTGVRFVQETDDMGQ
-------------------------------SDAETKRALEELTEKLNEAQRKEVVSDRVERRLQEIEREMRTEREVVERRQDQLGLISLQLQEALKKQE
AKADENEEVMKNKLRQTETEKSK-----------------------------------------------------------------------------
-------------------ELEEVKRCMERKDKERVHLAAQVE---------------------------------