Sequences
EST Library Info
cly3Lymph - RNA from China
fcc2Unavailable
fce1Foetus 100 days, cerebellum
hlv2Heart, left ventricle
jca1Joint capsule
nep2Newborn 115 days, epidermis
relu1Unavailable
ton3Tip of tongue, mucosal membrane
Clusters
Oligos
SNPs

Gene ID ENSG00000103510 (click for geneview)
Transcript ID ENST00000219797(link to ensembl)
Symbol MYST1
Localtion Chromosome:16:31036488:31050206:1 band: 16p11.2
Description MYST histone acetyltransferase 1 [Source:RefSeq_peptide;Acc:NP_115564]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--A--Q--G--A--A--A--A--V--A--A--G--T--S--G--V--A--G--E--G--E--P--G--P--G--E--N--A--A--A--E--G--
ATGGCGGCACAGGGAGCTGCTGCGGCGGTTGCGGCGGGGACTTCAGGGGTCGCGGGGGAGGGCGAGCCCGGGCCCGGGGAGAATGCGGCCGCTGAGGGGA
::::::::::::::::: :::::.:: :::::::::: ::::::::::::::::::::::::::::::::::::.:::::::::::::: :..:::::::
ATGGCGGCACAGGGAGCAGCTGCAGCCGTTGCGGCGGCGACTTCAGGGGTCGCGGGGGAGGGCGAGCCCGGGCCTGGGGAGAATGCGGCGGTCGAGGGGA
-M--A--A--Q--G--A--A--A--A--V--A--A--A--T--S--G--V--A--G--E--G--E--P--G--P--G--E--N--A--A--V--E--G--

----------------------------------------------------------------------------------------------------
T--A--P--S--P--G--R--V--S--P--P--T--P--A--R--G--E--P--E--V--T--V--E--I--G--E--T--Y--L--C--R--R--P--D
CCGCCCCATCCCCGGGCCGCGTCTCTCCGCCGACCCCGGCGCGCGGCGAGCCGGAAGTCACGGTGGAGATCGGAGAAACGTACCTGTGCCGGCGACCGGA
:::::::.:::::.::::::::::::::::::::::::::::: :: :::::::::::::: :::::.::.:::::::::::::::::::::::::::::
CCGCCCCGTCCCCAGGCCGCGTCTCTCCGCCGACCCCGGCGCGGGGAGAGCCGGAAGTCACCGTGGAAATTGGAGAAACGTACCTGTGCCGGCGACCGGA
T--A--P--S--P--G--R--V--S--P--P--T--P--A--R--G--E--P--E--V--T--V--E--I--G--E--T--Y--L--C--R--R--P--D

----------><-------------------------------------------------------------------------><-------------
--S--T--W--H--S--A--E--V--I--Q--S--R--V--N--D--Q--E--G--R--E--E--F--Y--V--H--Y--V--G--F--N--R--R--L-
TAGCACCTGGCATTCTGCTGAAGTGATCCAGTCTCGAGTGAACGACCAGGAGGGCCGAGAGGAATTCTATGTACACTACGTGGGCTTTAACCGGCGGCTG
::::::::::   ::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::.::::::   ::::::::.:::
TAGCACCTGG---TCTGCTGAAGTGATCCAGTCTCGAGTGAACGATCAGGAGGGCCGAGAGGAATTCTATGTACACTATGTGGGC---AACCGGCGACTG
--S--T--W-----S--A--E--V--I--Q--S--R--V--N--D--Q--E--G--R--E--E--F--Y--V--H--Y--V--G-----N--R--R--L-

----------------------------------------------------------------------------------------------------
-D--E--W--V--D--K--N--R--L--A--L--T--K--T--V--K--D--A--V--Q--K--N--S--E--K--Y--L--S--E--L--A--E--Q--
GACGAGTGGGTAGACAAGAACCGGCTGGCGCTGACCAAGACAGTGAAGGATGCTGTACAGAAGAACTCAGAGAAGTACCTGAGCGAGCTCGCAGAGCAGC
:::::.:::::::::::::::::::::::.:::::::::::::::::::::::.::.:::::::::::.::::::::::::::.::::: :: :::::::
GACGAATGGGTAGACAAGAACCGGCTGGCACTGACCAAGACAGTGAAGGATGCCGTGCAGAAGAACTCGGAGAAGTACCTGAGTGAGCTGGCTGAGCAGC
-D--E--W--V--D--K--N--R--L--A--L--T--K--T--V--K--D--A--V--Q--K--N--S--E--K--Y--L--S--E--L--A--E--Q--

-------------------------------------------------------------><-------------------------------------
P--E--R--K--I--T--R--N--Q--K--R--K--H--D--E--I--N--H--V--Q--K--T--Y--A--E--M--D--P--T--T--A--A--L--E
CTGAGCGCAAGATCACTCGCAACCAAAAGCGCAAGCATGATGAGATCAACCATGTGCAGAAGACTTATGCAGAGATGGACCCCACCACAGCAGCCTTGGA
:.:::::::::::::::::::::::::::::::::::.::::::::::::::.:::::::::::.::::: :::::::::::::: ::::::::::::::
CCGAGCGCAAGATCACTCGCAACCAAAAGCGCAAGCACGATGAGATCAACCACGTGCAGAAGACCTATGCTGAGATGGACCCCACGACAGCAGCCTTGGA
P--E--R--K--I--T--R--N--Q--K--R--K--H--D--E--I--N--H--V--Q--K--T--Y--A--E--M--D--P--T--T--A--A--L--E

---------------><-----------------------------------------------------------------------------------
--K--E--H--E--A--I--T--K--V--K--Y--V--D--K--I--H--I--G--N--Y--E--I--D--A--W--Y--F--S--P--F--P--E--D-
GAAGGAGCATGAGGCGATCACCAAGGTGAAGTATGTGGACAAGATCCACATCGGGAACTACGAAATTGATGCCTGGTATTTCTCACCATTCCCCGAAGAC
::::::.::.:::::::::::::::::::::::.:::::::::::::::::::: :::::::::::.:::::::::::.::::: ::.::::::::.:::
GAAGGAACACGAGGCGATCACCAAGGTGAAGTACGTGGACAAGATCCACATCGGCAACTACGAAATCGATGCCTGGTACTTCTCCCCGTTCCCCGAGGAC
--K--E--H--E--A--I--T--K--V--K--Y--V--D--K--I--H--I--G--N--Y--E--I--D--A--W--Y--F--S--P--F--P--E--D-

--------------------------------------------------------------------------------><------------------
-Y--G--K--Q--P--K--L--W--L--C--E--Y--C--L--K--Y--M--K--Y--E--K--S--Y--R--F--H--L--G--Q--C--Q--W--R--
TATGGGAAACAGCCCAAGCTCTGGCTCTGCGAGTACTGCCTCAAGTACATGAAATATGAGAAGAGCTACCGCTTCCACTTGGGTCAGTGCCAGTGGCGGC
::::::::.::::: ::.::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::
TATGGGAAGCAGCCGAAACTCTGGCTCTGCGAGTACTGTCTCAAGTACATGAAATATGAGAAGAGCTACCGCTTCCACTTGGGCCAGTGCCAGTGGCGGC
-Y--G--K--Q--P--K--L--W--L--C--E--Y--C--L--K--Y--M--K--Y--E--K--S--Y--R--F--H--L--G--Q--C--Q--W--R--

----------------------------------------------------------------------><----------------------------
Q--P--P--G--K--E--I--Y--R--K--S--N--I--S--V--Y--E--V--D--G--K--D--H--K--I--Y--C--Q--N--L--C--L--L--A
AGCCCCCCGGGAAAGAGATCTACCGCAAGAGCAACATCTCCGTGTACGAAGTTGATGGCAAAGACCATAAGATTTACTGTCAGAACCTGTGTCTGCTGGC
::::::: :::::.::::::::::::::::::::::::::.::::::::.:: ::.:::::::::::.::::::::::::::::::::::::::::::::
AGCCCCCGGGGAAGGAGATCTACCGCAAGAGCAACATCTCTGTGTACGAGGTGGACGGCAAAGACCACAAGATTTACTGTCAGAACCTGTGTCTGCTGGC
Q--P--P--G--K--E--I--Y--R--K--S--N--I--S--V--Y--E--V--D--G--K--D--H--K--I--Y--C--Q--N--L--C--L--L--A

----------------------------------------------------------------------------------------------------
--K--L--F--L--D--H--K--T--L--Y--F--D--V--E--P--F--V--F--Y--I--L--T--E--V--D--R--Q--G--A--H--I--V--G-
CAAGCTTTTCCTGGACCATAAGACACTGTACTTTGACGTGGAGCCGTTCGTCTTTTACATCCTGACTGAGGTGGACCGGCAGGGGGCCCACATTGTTGGC
::::::::::::::::::.:::::.:::::::::::::::::::::::::::::.::::::.::::.::::::::: ::::::::::.:::::.::.:::
CAAGCTTTTCCTGGACCACAAGACGCTGTACTTTGACGTGGAGCCGTTCGTCTTCTACATCTTGACCGAGGTGGACAGGCAGGGGGCTCACATCGTCGGC
--K--L--F--L--D--H--K--T--L--Y--F--D--V--E--P--F--V--F--Y--I--L--T--E--V--D--R--Q--G--A--H--I--V--G-

-----------><---------------------------------------------------------------------------------------
-Y--F--S--K--E--K--E--S--P--D--G--N--N--V--A--C--I--L--T--L--P--P--Y--Q--R--R--G--Y--G--K--F--L--I--
TACTTCTCCAAGGAGAAGGAGTCCCCGGATGGAAACAATGTGGCCTGCATCCTGACCTTGCCCCCCTACCAACGCCGCGGCTACGGGAAGTTCCTCATCG
::::::::::::::::::::::: ::.::.::.:::::.::::::::::::::::::.:::::::::::::.::::: :::::.::::::::::::::::
TACTTCTCCAAGGAGAAGGAGTCGCCAGACGGGAACAACGTGGCCTGCATCCTGACCCTGCCCCCCTACCAGCGCCGAGGCTATGGGAAGTTCCTCATCG
-Y--F--S--K--E--K--E--S--P--D--G--N--N--V--A--C--I--L--T--L--P--P--Y--Q--R--R--G--Y--G--K--F--L--I--

-----><---------------------------------------------------------------------------------------------
A--F--S--Y--E--L--S--K--L--E--S--T--V--G--S--P--E--K--P--L--S--D--L--G--K--L--S--Y--R--S--Y--W--S--W
CTTTCAGTTATGAGCTCTCCAAGCTGGAGAGCACAGTCGGCTCCCCGGAGAAGCCACTGTCTGACCTGGGCAAGCTCAGCTACCGCAGCTACTGGTCCTG
: :::   :::::::: :::::::::::::::::.:: :::::::: ::::::::.::::::::::::::::::::::::::::::::::::::::::::
CGTTC---TATGAGCTGTCCAAGCTGGAGAGCACGGTAGGCTCCCCTGAGAAGCCGCTGTCTGACCTGGGCAAGCTCAGCTACCGCAGCTACTGGTCCTG
A--F-----Y--E--L--S--K--L--E--S--T--V--G--S--P--E--K--P--L--S--D--L--G--K--L--S--Y--R--S--Y--W--S--W

--------------------------------------------------------><------------------------------------------
--V--L--L--E--I--L--R--D--F--R--G--T--L--S--I--K--D--L--S--Q--M--T--S--I--T--Q--N--D--I--I--S--T--L-
GGTGCTGCTAGAGATCCTGCGGGACTTCCGGGGCACACTGTCCATCAAGGACCTCAGCCAGATGACCAGTATCACCCAAAATGACATCATCAGTACCCTG
::: :::::.:::::::::::.:::::: :::::::::::::::::::::::      :::::::: :::::::::::.::::::::::::::.::::: 
GGTCCTGCTGGAGATCCTGCGAGACTTCAGGGGCACACTGTCCATCAAGGAC------CAGATGACGAGTATCACCCAGAATGACATCATCAGCACCCTC
--V--L--L--E--I--L--R--D--F--R--G--T--L--S--I--K--D--------Q--M--T--S--I--T--Q--N--D--I--I--S--T--L-

----------------------------------------------------------------------------------------------------
-Q--S--L--N--M--V--K--Y--W--K--G--Q--H--V--I--C--V--T--P--K--L--V--E--E--H--L--K--S--A--Q--Y--K--K--
CAATCCCTCAATATGGTCAAGTACTGGAAGGGCCAGCACGTGATCTGTGTCACACCCAAGCTGGTGGAGGAGCACCTCAAAAGTGCCCAGTATAAGAAAC
::.::::::::.:::::::::::::::::::::::::::::::::::.:::::.::::::::::::::::::::.:::::.:::::::::::::::::::
CAGTCCCTCAACATGGTCAAGTACTGGAAGGGCCAGCACGTGATCTGCGTCACGCCCAAGCTGGTGGAGGAGCATCTCAAGAGTGCCCAGTATAAGAAAC
-Q--S--L--N--M--V--K--Y--W--K--G--Q--H--V--I--C--V--T--P--K--L--V--E--E--H--L--K--S--A--Q--Y--K--K--

-----------><--------------------------------------------------------------->
P--P--I--T--V--D--S--V--C--L--K--W--A--P--P--K--H--K--Q--V--K--L--S--K--K--*-
CACCCATCACAGTGGACTCCGTCTGCCTCAAGTGGGCACCCCCCAAGCACAAGCAAGTCAAGCTCTCCAAGAAGTGA
:.:::::       :::::.:::::::::::::::::.:::::::::::::::::::::::.:::::::::::::::
CGCCCATA------GACTCTGTCTGCCTCAAGTGGGCGCCCCCCAAGCACAAGCAAGTCAAACTCTCCAAGAAGTGA
P--P--I--------D--S--V--C--L--K--W--A--P--P--K--H--K--Q--V--K--L--S--K--K--*-

Pig Consensus Sequence

>BGISUST0000896591
ATGGCGGCACAGGGAGCAGCTGCAGCCGTTGCGGCGGCGACTTCAGGGGTCGCGGGGGAGGGCGAGCCCGGGCCTGGGGAGAATGCGGCGGTCGAGGGGA
CCGCCCCGTCCCCAGGCCGCGTCTCTCCGCCGACCCCGGCGCGGGGAGAGCCGGAAGTCACCGTGGAAATTGGAGAAACGTACCTGTGCCGGCGACCGGA
TAGCACCTGG---TCTGCTGAAGTGATCCAGTCTCGAGTGAACGATCAGGAGGGCCGAGAGGAATTCTATGTACACTATGTGGGC---AACCGGCGACTG
GACGAATGGGTAGACAAGAACCGGCTGGCACTGACCAAGACAGTGAAGGATGCCGTGCAGAAGAACTCGGAGAAGTACCTGAGTGAGCTGGCTGAGCAGC
CCGAGCGCAAGATCACTCGCAACCAAAAGCGCAAGCACGATGAGATCAACCACGTGCAGAAGACCTATGCTGAGATGGACCCCACGACAGCAGCCTTGGA
GAAGGAACACGAGGCGATCACCAAGGTGAAGTACGTGGACAAGATCCACATCGGCAACTACGAAATCGATGCCTGGTACTTCTCCCCGTTCCCCGAGGAC
TATGGGAAGCAGCCGAAACTCTGGCTCTGCGAGTACTGTCTCAAGTACATGAAATATGAGAAGAGCTACCGCTTCCACTTGGGCCAGTGCCAGTGGCGGC
AGCCCCCGGGGAAGGAGATCTACCGCAAGAGCAACATCTCTGTGTACGAGGTGGACGGCAAAGACCACAAGATTTACTGTCAGAACCTGTGTCTGCTGGC
CAAGCTTTTCCTGGACCACAAGACGCTGTACTTTGACGTGGAGCCGTTCGTCTTCTACATCTTGACCGAGGTGGACAGGCAGGGGGCTCACATCGTCGGC
TACTTCTCCAAGGAGAAGGAGTCGCCAGACGGGAACAACGTGGCCTGCATCCTGACCCTGCCCCCCTACCAGCGCCGAGGCTATGGGAAGTTCCTCATCG
CGTTC---TATGAGCTGTCCAAGCTGGAGAGCACGGTAGGCTCCCCTGAGAAGCCGCTGTCTGACCTGGGCAAGCTCAGCTACCGCAGCTACTGGTCCTG
GGTCCTGCTGGAGATCCTGCGAGACTTCAGGGGCACACTGTCCATCAAGGAC------CAGATGACGAGTATCACCCAGAATGACATCATCAGCACCCTC
CAGTCCCTCAACATGGTCAAGTACTGGAAGGGCCAGCACGTGATCTGCGTCACGCCCAAGCTGGTGGAGGAGCATCTCAAGAGTGCCCAGTATAAGAAAC
CGCCCATA------GACTCTGTCTGCCTCAAGTGGGCGCCCCCCAAGCACAAGCAAGTCAAACTCTCCAAGAAGTGA


>BGISUSP0000896591
MAAQGAAAAVAAATSGVAGEGEPGPGENAAVEGTAPSPGRVSPPTPARGEPEVTVEIGETYLCRRPDSTW-SAEVIQSRVNDQEGREEFYVHYVG-NRRL
DEWVDKNRLALTKTVKDAVQKNSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVDKIHIGNYEIDAWYFSPFPED
YGKQPKLWLCEYCLKYMKYEKSYRFHLGQCQWRQPPGKEIYRKSNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVG
YFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAF-YELSKLESTVGSPEKPLSDLGKLSYRSYWSWVLLEILRDFRGTLSIKD--QMTSITQNDIISTL
QSLNMVKYWKGQHVICVTPKLVEEHLKSAQYKKPPI--DSVCLKWAPPKHKQVKLSKK*