Sequences
EST Library Info
mcp3Mammae, collostrum producing
med1Mediastinum
Clusters
Oligos
SNPs

Gene ID ENSG00000104064 (click for geneview)
Transcript ID ENST00000220429(link to ensembl)
Symbol GABP2_HUMAN
Localtion Chromosome:15:48356749:48434691:-1 band: 15q21.2
Description GA binding protein beta chain (GABP-beta-2 subunit) (GABP-2) (GABP- beta-1 subunit) (GABPB-1) (Transcription factor E4TF1-53) (Transcription factor E4TF1-47) (Nuclear respiratory factor-2).
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--S--L--V--D--L--G--K--K--L--L--E--A--A--R--A--G--Q--D--D--E--V--R--I--L--M--A--N--G--A--P--F--T--
ATGTCCCTGGTAGATTTGGGAAAGAAGCTTTTAGAAGCGGCACGAGCAGGTCAAGATGATGAAGTTCGTATTTTGATGGCAAATGGAGCTCCCTTTACTA
::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::: :::::::::::.:::::::
ATGTCCCTGGTAGATTTGGGAAAGAAGCTTTTAGAAGCAGCACGAGCAGGTCAAGATGATGAAGTTCGTATTTTGATGGCTAATGGAGCTCCTTTTACTA
-M--S--L--V--D--L--G--K--K--L--L--E--A--A--R--A--G--Q--D--D--E--V--R--I--L--M--A--N--G--A--P--F--T--

-------><-------------------------------------------------------------------------------------------
T--D--W--L--G--T--S--P--L--H--L--A--A--Q--Y--G--H--Y--S--T--T--E--V--L--L--R--A--G--V--S--R--D--A--R
CAGACTGGCTGGGAACTTCTCCACTTCATCTAGCAGCACAGTATGGTCATTATTCCACCACAGAGGTACTGCTGCGAGCTGGTGTGAGCAGAGATGCCAG
:::::::::::::::::::::::::::::. .:::::::::::.:: :::::::::::::::::.:::::.:: :::::::::::.::.::.::::::::
CAGACTGGCTGGGAACTTCTCCACTTCATTGGGCAGCACAGTACGGGCATTATTCCACCACAGAAGTACTACTTCGAGCTGGTGTAAGTAGGGATGCCAG
T--D--W--L--G--T--S--P--L--H--W--A--A--Q--Y--G--H--Y--S--T--T--E--V--L--L--R--A--G--V--S--R--D--A--R

---------------------------------------------------------------------------><-----------------------
--T--K--V--D--R--T--P--L--H--M--A--A--S--E--G--H--A--S--I--V--E--V--L--L--K--H--G--A--D--V--N--A--K-
AACCAAAGTGGACCGAACACCATTACATATGGCAGCTTCTGAGGGCCATGCCAGCATAGTAGAGGTTTTACTTAAGCATGGTGCTGATGTCAATGCAAAG
::::::::: ::::: ::.:::.:.::::::::::::::::::::::::::::::::::::::::::: .:::::::::::::::::::::::::: :::
AACCAAAGTTGACCGCACGCCACTGCATATGGCAGCTTCTGAGGGCCATGCCAGCATAGTAGAGGTTTGGCTTAAGCATGGTGCTGATGTCAATGCCAAG
--T--K--V--D--R--T--P--L--H--M--A--A--S--E--G--H--A--S--I--V--E--V--W--L--K--H--G--A--D--V--N--A--K-

----------------------------------------------------------------------------------------------------
-D--M--L--K--M--T--A--L--H--W--A--T--E--H--N--H--Q--E--V--V--E--L--L--I--K--Y--G--A--D--V--H--T--Q--
GACATGTTAAAGATGACAGCTCTCCATTGGGCCACAGAACACAATCATCAAGAGGTGGTGGAACTTTTAATCAAATATGGTGCTGATGTACACACGCAAA
::::::::.:::::::::::::: ::: :::::::::::::.:::::::::::.::::::::::::::::::::::::::::::::::::::::::::::
GACATGTTGAAGATGACAGCTCTACATGGGGCCACAGAACATAATCATCAAGAAGTGGTGGAACTTTTAATCAAATATGGTGCTGATGTACACACGCAAA
-D--M--L--K--M--T--A--L--H--G--A--T--E--H--N--H--Q--E--V--V--E--L--L--I--K--Y--G--A--D--V--H--T--Q--

----------------------------------------------------------------------><----------------------------
S--K--F--C--K--T--A--F--D--I--S--I--D--N--G--N--E--D--L--A--E--I--L--Q--I--A--M--Q--N--Q--I--N--T--N
GTAAATTTTGTAAAACTGCATTTGATATTTCAATAGACAATGGAAATGAAGATTTAGCAGAGATATTACAGATTGCTATGCAGAACCAAATCAACACAAA
:::::::: ::::::::::::: ::::::::::::::::: ::.::.::::::::::::::::::.::::::::::::::::::::::::::::::::::
GTAAATTTGGTAAAACTGCATTGGATATTTCAATAGACAAGGGGAACGAAGATTTAGCAGAGATACTACAGATTGCTATGCAGAACCAAATCAACACAAA
S--K--F--G--K--T--A--L--D--I--S--I--D--K--G--N--E--D--L--A--E--I--L--Q--I--A--M--Q--N--Q--I--N--T--N

----------------------------------------------------------------------------------><----------------
--P--E--S--P--D--T--V--T--I--H--A--A--T--P--Q--F--I--I--G--P--G--G--V--V--N--L--T--D--E--T--G--V--S-
CCCAGAGAGTCCTGACACTGTGACAATACATGCTGCAACACCACAGTTTATCATTGGACCTGGAGGGGTGGTGAACCTAACAGATGAAACGGGTGTATCT
::::::::::::.:::::::::::.::::::::.:: :::::.:::::::::::::::::::::::::::::::::::::::   ::.::::::::::::
CCCAGAGAGTCCCGACACTGTGACGATACATGCCGCCACACCGCAGTTTATCATTGGACCTGGAGGGGTGGTGAACCTAACA---GAGACGGGTGTATCT
--P--E--S--P--D--T--V--T--I--H--A--A--T--P--Q--F--I--I--G--P--G--G--V--V--N--L--T-----E--T--G--V--S-

------------------------------------------------------------------------------------------------><--
-A--V--Q--F--G--N--S--S--T--S--V--L--A--T--L--A--A--L--A--E--A--S--A--P--L--S--N--S--S--E--T--P--V--
GCTGTTCAGTTTGGAAACTCTTCTACATCAGTATTAGCTACATTAGCTGCCTTAGCTGAAGCATCTGCTCCATTGTCCAATTCTTCAGAAACTCCAGTAG
::::::::::::::::::::.::.::::::::::::::::::.:::::::::::::.::::::::::::::.::::::::::::::::::::::::   :
GCTGTTCAGTTTGGAAACTCCTCCACATCAGTATTAGCTACACTAGCTGCCTTAGCCGAAGCATCTGCTCCGTTGTCCAATTCTTCAGAAACTCCA---G
-A--V--Q--F--G--N--S--S--T--S--V--L--A--T--L--A--A--L--A--E--A--S--A--P--L--S--N--S--S--E--T--P-----

----------------------------------------------------------------------------------------------------
V--A--T--E--E--V--V--T--A--E--S--V--D--G--A--I--Q--Q--V--V--S--S--G--G--Q--Q--V--I--T--I--V--T--D--G
TGGCCACAGAAGAAGTAGTTACTGCAGAATCTGTGGATGGTGCCATTCAGCAAGTAGTTAGTTCAGGGGGTCAGCAAGTCATCACAATAGTTACAGATGG
::::.:::::.:::::::::::::::::::::::::::::::: :::::::::::::::::::::::::::::.::.::::::::.::::::::::::::
TGGCTACAGAGGAAGTAGTTACTGCAGAATCTGTGGATGGTGCAATTCAGCAAGTAGTTAGTTCAGGGGGTCAACAGGTCATCACGATAGTTACAGATGG
V--A--T--E--E--V--V--T--A--E--S--V--D--G--A--I--Q--Q--V--V--S--S--G--G--Q--Q--V--I--T--I--V--T--D--G

----------------------------------------------------------------------------------><----------------
--I--Q--L--G--N--L--H--S--I--P--T--S--G--I--G--Q--P--I--I--V--T--M--P--D--G--Q--Q--V--L--T--V--P--A-
AATTCAGCTTGGAAATTTGCACTCTATTCCAACCAGTGGAATTGGTCAGCCCATCATTGTGACCATGCCAGATGGACAACAAGTATTAACAGTACCAGCA
::::::::::::::::::::::::.::::::::::::::::: :::::::::::::::::::::::::::::::::::::::   :::::::::::::::
AATTCAGCTTGGAAATTTGCACTCCATTCCAACCAGTGGAATAGGTCAGCCCATCATTGTGACCATGCCAGATGGACAACAA---TTAACAGTACCAGCA
--I--Q--L--G--N--L--H--S--I--P--T--S--G--I--G--Q--P--I--I--V--T--M--P--D--G--Q--Q-----L--T--V--P--A-

--------------------------------------------------------------------------------------------------><
-T--D--I--A--E--E--T--V--I--S--E--E--P--P--A--K--R--Q--C--I--E--I--I--E--N--R--V--E--S--A--E--I--E--
ACAGACATTGCTGAAGAAACTGTTATAAGTGAAGAACCACCAGCTAAGAGACAATGTATCGAAATAATTGAAAACCGGGTGGAATCTGCAGAAATAGAAG
:::::::::::::::::::::::.::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::.::::::::::::::::
ACAGACATTGCTGAAGAAACTGTCATAAGTGAAGAACCACCAGCCAAGAGACAATGTATCGAAATAATTGAAAACCGGGTGGAGTCTGCAGAAATAGAAG
-T--D--I--A--E--E--T--V--I--S--E--E--P--P--A--K--R--Q--C--I--E--I--I--E--N--R--V--E--S--A--E--I--E--

----------------------------------------------------------------------------------------------------
E--R--E--A--L--Q--K--Q--L--D--E--A--N--R--E--A--Q--K--Y--R--Q--Q--L--L--K--K--E--Q--E--A--E--A--Y--R
AGAGAGAAGCTCTTCAGAAACAGCTGGATGAAGCAAATCGAGAAGCACAAAAATATCGACAGCAGCTCCTAAAGAAAGAACAGGAAGCAGAGGCCTACAG
:::::::::::::::::::::::::::::::::: ::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::
AGAGAGAAGCTCTTCAGAAACAGCTGGATGAAGCTAATCGAGAAGCACAAAAATATCGACAGCAGCTTCTAAAGAAAGAACAGGAAGCAGAGGCCTACAG
E--R--E--A--L--Q--K--Q--L--D--E--A--N--R--E--A--Q--K--Y--R--Q--Q--L--L--K--K--E--Q--E--A--E--A--Y--R

--------------------------------------------------->
--Q--K--L--E--A--M--T--R--L--Q--T--N--K--E--A--V--*-
ACAGAAGTTGGAAGCTATGACTCGTCTTCAGACTAATAAAGAAGCTGTTTAA
:::::::::.:::::.::::::::::::::::::::::::::::::::::::
ACAGAAGTTAGAAGCCATGACTCGTCTTCAGACTAATAAAGAAGCTGTTTAA
--Q--K--L--E--A--M--T--R--L--Q--T--N--K--E--A--V--*-

Pig Consensus Sequence

>BGISUST0000893314
ATGTCCCTGGTAGATTTGGGAAAGAAGCTTTTAGAAGCAGCACGAGCAGGTCAAGATGATGAAGTTCGTATTTTGATGGCTAATGGAGCTCCTTTTACTA
CAGACTGGCTGGGAACTTCTCCACTTCATTGGGCAGCACAGTACGGGCATTATTCCACCACAGAAGTACTACTTCGAGCTGGTGTAAGTAGGGATGCCAG
AACCAAAGTTGACCGCACGCCACTGCATATGGCAGCTTCTGAGGGCCATGCCAGCATAGTAGAGGTTTGGCTTAAGCATGGTGCTGATGTCAATGCCAAG
GACATGTTGAAGATGACAGCTCTACATGGGGCCACAGAACATAATCATCAAGAAGTGGTGGAACTTTTAATCAAATATGGTGCTGATGTACACACGCAAA
GTAAATTTGGTAAAACTGCATTGGATATTTCAATAGACAAGGGGAACGAAGATTTAGCAGAGATACTACAGATTGCTATGCAGAACCAAATCAACACAAA
CCCAGAGAGTCCCGACACTGTGACGATACATGCCGCCACACCGCAGTTTATCATTGGACCTGGAGGGGTGGTGAACCTAACA---GAGACGGGTGTATCT
GCTGTTCAGTTTGGAAACTCCTCCACATCAGTATTAGCTACACTAGCTGCCTTAGCCGAAGCATCTGCTCCGTTGTCCAATTCTTCAGAAACTCCA---G
TGGCTACAGAGGAAGTAGTTACTGCAGAATCTGTGGATGGTGCAATTCAGCAAGTAGTTAGTTCAGGGGGTCAACAGGTCATCACGATAGTTACAGATGG
AATTCAGCTTGGAAATTTGCACTCCATTCCAACCAGTGGAATAGGTCAGCCCATCATTGTGACCATGCCAGATGGACAACAA---TTAACAGTACCAGCA
ACAGACATTGCTGAAGAAACTGTCATAAGTGAAGAACCACCAGCCAAGAGACAATGTATCGAAATAATTGAAAACCGGGTGGAGTCTGCAGAAATAGAAG
AGAGAGAAGCTCTTCAGAAACAGCTGGATGAAGCTAATCGAGAAGCACAAAAATATCGACAGCAGCTTCTAAAGAAAGAACAGGAAGCAGAGGCCTACAG
ACAGAAGTTAGAAGCCATGACTCGTCTTCAGACTAATAAAGAAGCTGTTTAA


>BGISUSP0000893314
MSLVDLGKKLLEAARAGQDDEVRILMANGAPFTTDWLGTSPLHWAAQYGHYSTTEVLLRAGVSRDARTKVDRTPLHMAASEGHASIVEVWLKHGADVNAK
DMLKMTALHGATEHNHQEVVELLIKYGADVHTQSKFGKTALDISIDKGNEDLAEILQIAMQNQINTNPESPDTVTIHAATPQFIIGPGGVVNLT-ETGVS
AVQFGNSSTSVLATLAALAEASAPLSNSSETP-VATEEVVTAESVDGAIQQVVSSGGQQVITIVTDGIQLGNLHSIPTSGIGQPIIVTMPDGQQ-LTVPA
TDIAEETVISEEPPAKRQCIEIIENRVESAEIEEREALQKQLDEANREAQKYRQQLLKKEQEAEAYRQKLEAMTRLQTNKEAV*