Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000012232 (click for geneview)
Transcript ID ENST00000220562(link to ensembl)
Symbol EXTL3
Localtion Chromosome:8:28615050:28667116:1 band: 8p21.1
Description Exostosin-like 3 (EC 2.4.1.223) (Glucuronyl-galactosyl-proteoglycan 4- alpha-N-acetylglucosaminyltransferase) (Putative tumor suppressor protein EXTL3) (Multiple exostosis-like protein 3) (Hereditary multiple exostoses gene isolog) (EXT-related protein 1) [Source:Uniprot/SWISSPROT;Acc:O43909]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--T--G--Y--T--M--L--R--N--G--G--A--G--N--G--G--Q--T--C--M--L--R--W--S--N--R--I--R--L--T--W--L--S--
ATGACAGGCTATACCATGCTGCGGAATGGGGGCGCGGGGAACGGAGGTCAGACCTGCATGCTGCGCTGGTCCAACCGCATCCGCCTCACGTGGCTCAGCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
F--T--L--F--V--I--L--V--F--F--P--L--I--A--H--Y--Y--L--T--T--L--D--E--A--D--E--A--G--K--R--I--F--G--P
TCACGCTCTTTGTCATCCTGGTCTTCTTCCCGCTCATCGCCCACTATTACCTCACCACTCTGGATGAGGCTGATGAGGCAGGCAAGCGGATTTTTGGTCC
                       :::::::: ::::::::.::::::::.::::::::.:::::.::::: ::.:::::::::::::::::::::::.::
-----------------------TTCTTCCCCCTCATCGCTCACTATTATCTCACCACCCTGGACGAGGCGGACGAGGCAGGCAAGCGGATTTTTGGCCC
------------------------F--F--P--L--I--A--H--Y--Y--L--T--T--L--D--E--A--D--E--A--G--K--R--I--F--G--P

----------------------------------------------------------------------------------------------------
--R--V--G--N--E--L--C--E--V--K--H--V--L--D--L--C--R--I--R--E--S--V--S--E--E--L--L--Q--L--E--A--K--R-
CCGGGTGGGGAACGAGCTGTGCGAGGTGAAGCACGTGCTGGATCTGTGCCGCATCCGGGAGTCGGTGAGTGAAGAGCTCCTGCAGCTGGAGGCCAAGCGC
 ::::. :: :..::::: ::.:::::.::::::::::::::::: ::::::::::: ::::: :: ::::::::::::.::::::::::.:::::::: 
ACGGGCTGGTAGTGAGCTCTGTGAGGTAAAGCACGTGCTGGATCTCTGCCGCATCCGTGAGTCTGTCAGTGAAGAGCTCTTGCAGCTGGAAGCCAAGCGG
--R--A--G--S--E--L--C--E--V--K--H--V--L--D--L--C--R--I--R--E--S--V--S--E--E--L--L--Q--L--E--A--K--R-

----------------------------------------------------------------------------------------------------
-Q--E--L--N--S--E--I--A--K--L--N--L--K--I--E--A--C--K--K--S--I--E--N--A--K--Q--D--L--L--Q--L--K--N--
CAAGAGCTGAACAGCGAGATCGCCAAGCTGAATCTGAAGATCGAAGCCTGTAAGAAGAGCATTGAGAACGCCAAGCAGGACCTGCTCCAGCTCAAGAATG
::::::::::::::.::.:::::::::::::::::::::::.:::::::::::::::::.::.:::::.:: ::::::::::::::::::::::::::.:
CAAGAGCTGAACAGTGAAATCGCCAAGCTGAATCTGAAGATTGAAGCCTGTAAGAAGAGTATCGAGAATGCAAAGCAGGACCTGCTCCAGCTCAAGAACG
-Q--E--L--N--S--E--I--A--K--L--N--L--K--I--E--A--C--K--K--S--I--E--N--A--K--Q--D--L--L--Q--L--K--N--

----------------------------------------------------------------------------------------------------
V--I--S--Q--T--E--H--S--Y--K--E--L--M--A--Q--N--Q--P--K--L--S--L--P--I--R--L--L--P--E--K--D--D--A--G
TCATCAGCCAGACCGAGCATTCCTACAAGGAGCTCATGGCCCAGAACCAGCCCAAGCTGTCCCTGCCCATCCGACTGCTCCCAGAGAAGGACGATGCCGG
:::::::::::::.:::::.:::::.::.::::: ::::::::.::.::::::::.:: ::.:::::::::::::: ::::: ::::::::.:::::.::
TCATCAGCCAGACTGAGCACTCCTATAAAGAGCTGATGGCCCAAAATCAGCCCAAACTTTCTCTGCCCATCCGACTCCTCCCCGAGAAGGATGATGCTGG
V--I--S--Q--T--E--H--S--Y--K--E--L--M--A--Q--N--Q--P--K--L--S--L--P--I--R--L--L--P--E--K--D--D--A--G

----------------------------------------------------------------------------------------------------
--L--P--P--P--K--A--T--R--G--C--R--L--H--N--C--F--D--Y--S--R--C--P--L--T--S--G--F--P--V--Y--V--Y--D-
CCTCCCTCCCCCGAAGGCCACTCGGGGCTGCCGGCTACACAACTGCTTTGATTATTCTCGTTGCCCTCTCACCTCTGGCTTCCCGGTCTACGTCTATGAC
:::.::::::::.::::.: ..::::::::::::::.:::::.::.:::::::::::::::::::::::::::::::::::.::.:::::.::.::::::
CCTTCCTCCCCCAAAGGTCCTCCGGGGCTGCCGGCTGCACAATTGTTTTGATTATTCTCGTTGCCCTCTCACCTCTGGCTTTCCAGTCTATGTTTATGAC
--L--P--P--P--K--V--L--R--G--C--R--L--H--N--C--F--D--Y--S--R--C--P--L--T--S--G--F--P--V--Y--V--Y--D-

----------------------------------------------------------------------------------------------------
-S--D--Q--F--V--F--G--S--Y--L--D--P--L--V--K--Q--A--F--Q--A--T--A--R--A--N--V--Y--V--T--E--N--A--D--
AGTGACCAGTTTGTCTTTGGCAGCTACCTGGATCCCTTGGTCAAGCAGGCTTTTCAGGCGACAGCACGAGCTAACGTTTATGTTACAGAAAATGCAGACA
:::::::::::::.::::::::::::::::::::::::::::::::::::::::::::: :::::::::::.::.:: ::::::::::::::::::::::
AGTGACCAGTTTGCCTTTGGCAGCTACCTGGATCCCTTGGTCAAGCAGGCTTTTCAGGCCACAGCACGAGCCAATGTGTATGTTACAGAAAATGCAGACA
-S--D--Q--F--A--F--G--S--Y--L--D--P--L--V--K--Q--A--F--Q--A--T--A--R--A--N--V--Y--V--T--E--N--A--D--

----------------------------------------------------------------------------------------------------
I--A--C--L--Y--V--I--L--V--G--E--M--Q--E--P--V--V--L--R--P--A--E--L--E--K--Q--L--Y--S--L--P--H--W--R
TCGCCTGCCTTTACGTGATACTAGTGGGAGAGATGCAGGAGCCGGTGGTGCTGCGGCCTGCTGAGCTGGAGAAGCAGTTGTATTCCCTGCCACACTGGCG
:.:::::::::::.::::: .:::::::::::::::::::::::::::::::::::::::: ::.:: ::::..:: :::::::::::.:::::::::::
TTGCCTGCCTTTATGTGATCTTAGTGGGAGAGATGCAGGAGCCGGTGGTGCTGCGGCCTGCGGAACTTGAGAGACATTTGTATTCCCTACCACACTGGCG
I--A--C--L--Y--V--I--L--V--G--E--M--Q--E--P--V--V--L--R--P--A--E--L--E--R--H--L--Y--S--L--P--H--W--R

----------------------------------------------------------------------------------------------------
--T--D--G--H--N--H--V--I--I--N--L--S--R--K--S--D--T--Q--N--L--L--Y--N--V--S--T--G--R--A--M--V--A--Q-
GACGGATGGACACAACCATGTCATCATCAATCTGTCACGTAAGTCAGATACACAGAACCTTCTCTATAACGTCAGTACTGGCCGTGCCATGGTGGCCCAG
:::.:::::.::::::::.:::::::::::.::::: :: :.:::.::.::.:::::..: .: ::.::.:::::::: :::::::::::::::::::::
GACAGATGGGCACAACCACGTCATCATCAACCTGTCTCGGAGGTCGGACACGCAGAATTTATTGTACAATGTCAGTACAGGCCGTGCCATGGTGGCCCAG
--T--D--G--H--N--H--V--I--I--N--L--S--R--R--S--D--T--Q--N--L--L--Y--N--V--S--T--G--R--A--M--V--A--Q-

----------------------------------------------------------------------------------------------------
-S--T--F--Y--T--V--Q--Y--R--P--G--F--D--L--V--V--S--P--L--V--H--A--M--S--E--P--N--F--M--E--I--P--P--
TCCACCTTCTACACTGTCCAGTACAGACCTGGCTTTGACTTGGTCGTATCACCGCTGGTCCATGCCATGTCTGAGCCCAACTTCATGGAAATCCCACCAC
:::::.:::::..:::.:::::::::.::::::::::::::::: ::::::::.::.:::::::::::::: :::::::::::.::::::::::::::.:
TCCACTTTCTATGCTGCCCAGTACAGGCCTGGCTTTGACTTGGTGGTATCACCACTAGTCCATGCCATGTCAGAGCCCAACTTTATGGAAATCCCACCGC
-S--T--F--Y--A--A--Q--Y--R--P--G--F--D--L--V--V--S--P--L--V--H--A--M--S--E--P--N--F--M--E--I--P--P--

----------------------------------------------------------------------------------------------------
Q--V--P--V--K--R--K--Y--L--F--T--F--Q--G--E--K--I--E--S--L--R--S--S--L--Q--E--A--R--S--F--E--E--E--M
AGGTGCCGGTGAAGCGGAAATATCTCTTCACCTTCCAGGGCGAGAAGATTGAGTCTCTGAGGTCTAGCCTTCAGGAGGCCCGCTCCTTCGAAGAGGAAAT
:::::::.:::::::::::.::::::::::::::::::::.:::::::::::::: :::::.::.::::::::::::::.::.:::::.::.:::::.::
AGGTGCCAGTGAAGCGGAAGTATCTCTTCACCTTCCAGGGTGAGAAGATTGAGTCGCTGAGATCCAGCCTTCAGGAGGCTCGTTCCTTTGAGGAGGAGAT
Q--V--P--V--K--R--K--Y--L--F--T--F--Q--G--E--K--I--E--S--L--R--S--S--L--Q--E--A--R--S--F--E--E--E--M

----------------------------------------------------------------------------------------------------
--E--G--D--P--P--A--D--Y--D--D--R--I--I--A--T--L--K--A--V--Q--D--S--K--L--D--Q--V--L--V--E--F--T--C-
GGAGGGCGACCCTCCCGCCGACTACGATGACCGGATCATTGCCACCCTGAAGGCGGTGCAGGACAGCAAGCTGGATCAGGTCCTGGTGGAATTCACCTGC
::::::::::::::: :: ::::::::.::.:: :::::::::::::: ::::: :::::::::::::::::.::.:::::                   
GGAGGGCGACCCTCCAGCAGACTACGACGATCGCATCATTGCCACCCTCAAGGCTGTGCAGGACAGCAAGCTAGACCAGGTG------------------
--E--G--D--P--P--A--D--Y--D--D--R--I--I--A--T--L--K--A--V--Q--D--S--K--L--D--Q--V-------------------

----------------------------------------------------------------------------------------------------
-K--N--Q--P--K--P--S--L--P--T--E--W--A--L--C--G--E--R--E--D--R--L--E--L--L--K--L--S--T--F--A--L--I--
AAAAACCAGCCCAAACCCAGCCTGCCGACTGAGTGGGCACTGTGTGGAGAGCGGGAGGACCGCTTGGAATTGCTGAAGCTCTCCACCTTCGCCCTCATCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
I--T--P--G--D--P--R--L--V--I--S--S--G--C--A--T--R--L--F--E--A--L--E--V--G--A--V--P--V--V--L--G--E--Q
TTACCCCCGGGGACCCTCGCTTGGTTATTTCCTCTGGGTGTGCAACACGGCTCTTCGAAGCCCTGGAAGTCGGTGCCGTCCCGGTGGTGCTGGGGGAGCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--V--Q--L--P--Y--Q--D--M--L--Q--W--N--E--A--A--L--V--V--P--K--P--R--V--T--E--V--H--F--L--L--R--S--L-
GGTCCAGCTTCCCTACCAGGACATGCTGCAGTGGAACGAGGCGGCCCTGGTGGTGCCAAAGCCTCGTGTTACCGAGGTTCATTTCCTGCTCAGAAGCCTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-S--D--S--D--L--L--A--M--R--R--Q--G--R--F--L--W--E--T--Y--F--S--T--A--D--S--I--F--N--T--V--L--A--M--
TCCGATAGTGACCTCCTGGCTATGAGGCGGCAAGGCCGCTTTCTCTGGGAGACTTACTTCTCCACTGCTGACAGTATTTTTAATACCGTGCTGGCTATGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
I--R--T--R--I--Q--I--P--A--A--P--I--R--E--E--A--A--A--E--I--P--H--R--S--G--K--A--A--G--T--D--P--N--M
TTAGGACTCGCATCCAGATCCCAGCCGCTCCCATCCGGGAAGAGGCGGCAGCTGAGATCCCCCACCGTTCAGGCAAGGCGGCTGGAACTGACCCCAACAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--A--D--N--G--D--L--D--L--G--P--V--E--T--E--P--P--Y--A--S--P--R--Y--L--R--N--F--T--L--T--V--T--D--F-
GGCTGACAACGGGGACCTGGACCTGGGGCCAGTGGAGACGGAGCCGCCCTACGCCTCACCCAGATACCTCCGCAATTTCACTCTGACTGTCACTGACTTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-Y--R--S--W--N--C--A--P--G--P--F--H--L--F--P--H--T--P--F--D--P--V--L--P--S--E--A--K--F--L--G--S--G--
TACCGCAGCTGGAACTGTGCTCCAGGGCCTTTCCATCTTTTCCCCCACACTCCCTTTGACCCTGTGTTGCCCTCAGAGGCCAAATTCTTGGGCTCAGGGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
T--G--F--R--P--I--G--G--G--A--G--G--S--G--K--E--F--Q--A--A--L--G--G--N--V--P--R--E--Q--F--T--V--V--M
CTGGCTTTCGGCCTATTGGTGGTGGAGCTGGGGGTTCTGGCAAGGAATTTCAGGCAGCGCTTGGAGGCAATGTTCCCCGAGAGCAGTTCACGGTGGTGAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--L--T--Y--E--R--E--E--V--L--M--N--S--L--E--R--L--N--G--L--P--Y--L--N--K--V--V--V--V--W--N--S--P--K-
GTTGACTTATGAGCGGGAGGAAGTGCTTATGAACTCTTTAGAGAGGCTGAATGGCCTCCCTTACCTGAACAAGGTCGTGGTGGTGTGGAATTCTCCCAAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------------------------><---------------------------------------------------
-L--P--S--E--D--L--L--W--P--D--I--G--V--P--I--M--V--V--R--T--E--K--N--S--L--N--N--R--F--L--P--W-----
CTGCCATCAGAGGACCTTCTGTGGCCTGACATTGGCGTCCCCATCATGGTGGTCCGTACTGAGAAGAACAGTTTGAACAACCGATTCTTACCCTGG---A
                                                :::::::::::::::::::::::..:::::::.::::::.:.::::::   :
------------------------------------------------GTGGTCCGTACTGAGAAGAACAGCCTGAACAATCGATTCCTGCCCTGGC--A
-------------------------------------------------V--V--R--T--E--K--N--S--L--N--N--R--F--L--P--W--\--

---------------------------------------------------------------------------------><-----------------
N--E--I--E--T--E--A--I--L--S--I--D--D--D--A--H--L--R--H--D--E--I--M--F--G--F--R--V--W--R--E--A--R--D
ATGAAATTGAGACAGAGGCCATCCTGTCCATTGATGACGATGCTCACCTCCGCCATGACGAAATCATGTTTGGGTTCCGGGTGTGGAGAGAAGCTCGGGA
:::::::.::::::::::::::::::::.::::::::.::::::   ::::::::.:::::.::::::            :::::::::::::: :::::
ATGAAATCGAGACAGAGGCCATCCTGTCTATTGATGATGATGCTAC-CTCCGCCACGACGAGATCATG------------GTGTGGAGAGAAGCACGGGA
N--E--I--E--T--E--A--I--L--S--I--D--D--D--A--H--L--R--H--D--E--I--M--------------V--W--R--E--A--R--D

----------------------------------------------------------------------------------------------------
--R--I--V--G--F--P--G--R--Y--H--A--W--D--I--P--H--Q--S--W--L--Y--N--S--N--Y--S--C--E--L--S--M--V--L-
CCGCATCGTGGGCTTCCCTGGCCGTTACCACGCATGGGACATCCCCCATCAGTCCTGGCTCTACAACTCCAACTACTCCTGTGAGCTGTCCATGGTGCTG
::::::.:::::.:::::::::::::::::.::.:::::::: :: :::::::: :::::::::::::::::::::::::::::::::::::::::::::
CCGCATTGTGGGTTTCCCTGGCCGTTACCATGCGTGGGACATACCGCATCAGTCGTGGCTCTACAACTCCAACTACTCCTGTGAGCTGTCCATGGTGCTG
--R--I--V--G--F--P--G--R--Y--H--A--W--D--I--P--H--Q--S--W--L--Y--N--S--N--Y--S--C--E--L--S--M--V--L-

--------------------------><------------------------------------------------------------------------
-T--G--A--A--F--F--H--K--Y--Y--A--Y--L--Y--S--Y--V--M--P--Q--A--I--R--D--M--V--D--E--Y--I--N--C--E--
ACAGGTGCTGCCTTCTTTCACAAGTATTATGCCTACCTGTATTCTTATGTGATGCCCCAGGCCATCCGGGACATGGTGGATGAATACATCAACTGTGAGG
::: :::::::::::::.:::::::::::::::::::::::::::::.::::::::::::::::::::.::.::::::::::::::::::::::::::::
ACATGTGCTGCCTTCTTCCACAAGTATTATGCCTACCTGTATTCTTACGTGATGCCCCAGGCCATCCGAGATATGGTGGATGAATACATCAACTGTGAGG
-T--C--A--A--F--F--H--K--Y--Y--A--Y--L--Y--S--Y--V--M--P--Q--A--I--R--D--M--V--D--E--Y--I--N--C--E--

-------------------------------------------------------><-------------------------------------------
D--I--A--M--N--F--L--V--S--H--I--T--R--K--P--P--I--K--V--T--S--R--W--T--F--R--C--P--G--C--P--Q--A--L
ACATTGCCATGAACTTCCTTGTCTCCCACATCACTCGGAAGCCCCCCATCAAGGTGACCTCACGGTGGACATTCCGATGCCCAGGATGCCCTCAGGCCCT
:::::::::::::.:::::.::::::::::::::::::::.::::::::::::                                               
ACATTGCCATGAATTTCCTCGTCTCCCACATCACTCGGAAACCCCCCATCAAG-----------------------------------------------
D--I--A--M--N--F--L--V--S--H--I--T--R--K--P--P--I--K------------------------------------------------

----------------------------------------------------------------------------------------------------
--S--H--D--D--S--H--F--H--E--R--H--K--C--I--N--F--F--V--K--V--Y--G--Y--M--P--L--L--Y--T--Q--F--R--V-
GTCTCATGATGACTCCCACTTCCACGAGCGGCACAAGTGCATCAACTTCTTCGTGAAGGTGTACGGCTACATGCCCCTCCTGTACACGCAGTTCAGGGTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------------------------------------------
-D--S--V--L--F--K--T--R--L--P--H--D--K--T--K--C--F--K--F--I--*-
GATTCTGTGCTCTTCAAGACACGCCTGCCCCATGACAAGACCAAGTGCTTCAAGTTCATCTAG
                                                               
---------------------------------------------------------------
---------------------------------------------------------------

Pig Consensus Sequence

>BGISUST0000895045
----------------------------------------------------------------------------------------------------
-----------------------TTCTTCCCCCTCATCGCTCACTATTATCTCACCACCCTGGACGAGGCGGACGAGGCAGGCAAGCGGATTTTTGGCCC
ACGGGCTGGTAGTGAGCTCTGTGAGGTAAAGCACGTGCTGGATCTCTGCCGCATCCGTGAGTCTGTCAGTGAAGAGCTCTTGCAGCTGGAAGCCAAGCGG
CAAGAGCTGAACAGTGAAATCGCCAAGCTGAATCTGAAGATTGAAGCCTGTAAGAAGAGTATCGAGAATGCAAAGCAGGACCTGCTCCAGCTCAAGAACG
TCATCAGCCAGACTGAGCACTCCTATAAAGAGCTGATGGCCCAAAATCAGCCCAAACTTTCTCTGCCCATCCGACTCCTCCCCGAGAAGGATGATGCTGG
CCTTCCTCCCCCAAAGGTCCTCCGGGGCTGCCGGCTGCACAATTGTTTTGATTATTCTCGTTGCCCTCTCACCTCTGGCTTTCCAGTCTATGTTTATGAC
AGTGACCAGTTTGCCTTTGGCAGCTACCTGGATCCCTTGGTCAAGCAGGCTTTTCAGGCCACAGCACGAGCCAATGTGTATGTTACAGAAAATGCAGACA
TTGCCTGCCTTTATGTGATCTTAGTGGGAGAGATGCAGGAGCCGGTGGTGCTGCGGCCTGCGGAACTTGAGAGACATTTGTATTCCCTACCACACTGGCG
GACAGATGGGCACAACCACGTCATCATCAACCTGTCTCGGAGGTCGGACACGCAGAATTTATTGTACAATGTCAGTACAGGCCGTGCCATGGTGGCCCAG
TCCACTTTCTATGCTGCCCAGTACAGGCCTGGCTTTGACTTGGTGGTATCACCACTAGTCCATGCCATGTCAGAGCCCAACTTTATGGAAATCCCACCGC
AGGTGCCAGTGAAGCGGAAGTATCTCTTCACCTTCCAGGGTGAGAAGATTGAGTCGCTGAGATCCAGCCTTCAGGAGGCTCGTTCCTTTGAGGAGGAGAT
GGAGGGCGACCCTCCAGCAGACTACGACGATCGCATCATTGCCACCCTCAAGGCTGTGCAGGACAGCAAGCTAGACCAGGTG------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
------------------------------------------------GTGGTCCGTACTGAGAAGAACAGCCTGAACAATCGATTCCTGCCCTGgaATG
AAATCGAGACAGAGGCCATCCTGTCTATTGATGATGATGCtcTCCGCCACGACGAGATCATG------------GTGTGGAGAGAAGCACGGGACCGCAT
TGTGGGTTTCCCTGGCCGTTACCATGCGTGGGACATACCGCATCAGTCGTGGCTCTACAACTCCAACTACTCCTGTGAGCTGTCCATGGTGCTGACATGT
GCTGCCTTCTTCCACAAGTATTATGCCTACCTGTATTCTTACGTGATGCCCCAGGCCATCCGAGATATGGTGGATGAATACATCAACTGTGAGGACATTG
CCATGAATTTCCTCGTCTCCCACATCACTCGGAAACCCCCCATCAAG-----------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------------------------------------------------


>BGISUSP0000895045
-----------------------------------------FFPLIAHYYLTTLDEADEAGKRIFGPRAGSELCEVKHVLDLCRIRESVSEELLQLEAKR
QELNSEIAKLNLKIEACKKSIENAKQDLLQLKNVISQTEHSYKELMAQNQPKLSLPIRLLPEKDDAGLPPPKVLRGCRLHNCFDYSRCPLTSGFPVYVYD
SDQFAFGSYLDPLVKQAFQATARANVYVTENADIACLYVILVGEMQEPVVLRPAELERHLYSLPHWRTDGHNHVIINLSRRSDTQNLLYNVSTGRAMVAQ
STFYAAQYRPGFDLVVSPLVHAMSEPNFMEIPPQVPVKRKYLFTFQGEKIESLRSSLQEARSFEEEMEGDPPADYDDRIIATLKAVQDSKLDQV------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------VVRTEKNSLNNRFLPWNEIETEAILSIDDDALRHDEIM----VWREARDRIVGFPGRYHAWDIPHQSWLYNSNYSCELSMVLTC
AAFFHKYYAYLYSYVMPQAIRDMVDEYINCEDIAMNFLVSHITRKPPIK---------------------------------------------------
-------------------