Sequences
EST Library Info
plac4Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000106266 (click for geneview)
Transcript ID ENST00000222990(link to ensembl)
Symbol SNX8
Localtion Chromosome:7:2067882:2127340:-1 band: 7p22.3
Description Sorting nexin 8. [Source:Uniprot/SWISSPROT;Acc:Q9Y5X2]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<--------------------------------------------------------------------------------------------><-----
-M--T--G--R--A--M--D--P--L--P--A--A--A--V--G--A--A--A--E--A--E--A--D--E--E--A--D--P--P--A--S--D--L--
ATGACTGGCCGCGCGATGGACCCGCTGCCCGCGGCTGCAGTCGGGGCGGCAGCTGAGGCGGAGGCTGACGAGGAGGCGGATCCCCCGGCGTCAGATCTGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
P--T--P--Q--A--I--E--P--Q--A--I--V--Q--Q--V--P--A--P--S--R--M--Q--M--P--Q--G--N--P--L--L--L--S--H--T
CGACACCCCAGGCCATCGAGCCCCAGGCCATCGTGCAGCAGGTCCCAGCCCCCAGTCGAATGCAGATGCCGCAGGGGAACCCGCTGCTGCTGTCCCACAC
     :::::::.:: .:::::   :::: :                : :.:::::::.::::::::::::: ::::::::::::::::::::: : :::
-----CCCCAGGTCAGTGAGCCGACGGCCCTG---------------GACTCCAGTCGGATGCAGATGCCGCCGGGGAACCCGCTGCTGCTGTCGCTCAC
------P--Q--V--S--E--P--T--A--L-----------------D--S--S--R--M--Q--M--P--P--G--N--P--L--L--L--S--L--T

--------------------------------------------------------------------------------------------------->
--L--Q--E--L--L--A--R--D--T--V--Q--V--E--L--I--P--E--K--K--G--L--F--L--K--H--V--E--Y--E--V--S--S--Q-
CCTGCAGGAGCTGCTGGCCAGGGACACCGTGCAGGTGGAGCTCATTCCGGAGAAGAAGGGCCTCTTCCTGAAGCATGTGGAGTATGAGGTTTCCAGCCAG
 :::::::::::::::::: : :::.:::::::::::::::::::.:: ::::::::::::::::::::::::::.::::::::::::::::::::::::
GCTGCAGGAGCTGCTGGCCCGCGACGCCGTGCAGGTGGAGCTCATCCCTGAGAAGAAGGGCCTCTTCCTGAAGCACGTGGAGTATGAGGTTTCCAGCCAG
--L--Q--E--L--L--A--R--D--A--V--Q--V--E--L--I--P--E--K--K--G--L--F--L--K--H--V--E--Y--E--V--S--S--Q-

<---------------------------------------------------------------------------------------------------
-R--F--K--S--S--V--Y--R--R--Y--N--D--F--V--V--F--Q--E--M--L--L--H--K--F--P--Y--R--M--V--P--A--L--P--
CGCTTCAAGTCCTCGGTATACAGACGGTACAATGACTTCGTGGTCTTCCAGGAGATGCTCCTGCACAAGTTCCCCTACCGTATGGTGCCTGCCCTGCCAC
::::::::::: :: ::.::: ::::::::::::::::.::::::::::: :::::::: ::::: :::::::: :::::.:::::::: ::::: ::.:
CGCTTCAAGTCGTCCGTGTACCGACGGTACAATGACTTTGTGGTCTTCCACGAGATGCTGCTGCAGAAGTTCCCGTACCGCATGGTGCCAGCCCTTCCGC
-R--F--K--S--S--V--Y--R--R--Y--N--D--F--V--V--F--H--E--M--L--L--Q--K--F--P--Y--R--M--V--P--A--L--P--

-----------------><---------------------------------------------------------------------------------
P--K--R--M--L--G--A--D--R--E--F--I--E--A--R--R--R--A--L--K--R--F--V--N--L--V--A--R--H--P--L--F--S--E
CCAAGAGAATGCTGGGAGCTGACAGGGAGTTCATCGAGGCCAGGAGGAGAGCCCTGAAGCGCTTCGTCAACCTGGTGGCGCGACACCCCCTGTTCTCCGA
:::::::.:::::::::   ::::::::::::::::::::  :::::::::::::::::::::::.::::::::::::: ::.::::: :. ::::::::
CCAAGAGGATGCTGGGA---GACAGGGAGTTCATCGAGGCGCGGAGGAGAGCCCTGAAGCGCTTCATCAACCTGGTGGCCCGGCACCCGCCCTTCTCCGA
P--K--R--M--L--G-----D--R--E--F--I--E--A--R--R--R--A--L--K--R--F--I--N--L--V--A--R--H--P--P--F--S--E

---------------------------------------><-----------------------------------------------------------
--D--V--V--L--K--L--F--L--S--F--S--G--S--D--V--Q--N--K--L--K--E--S--A--Q--C--V--G--D--E--F--L--N--C-
GGATGTGGTCCTCAAGCTCTTCCTGTCCTTCAGCGGCTCGGATGTGCAGAACAAGTTAAAGGAGTCAGCACAGTGCGTCGGGGACGAATTCCTGAACTGT
:::.:: :: :::::::::::::::::::::::::::   :::::::::::::::::::::::.:: :: :::::.:: ::.::.:::::: ::::.::.
GGACGTCGTGCTCAAGCTCTTCCTGTCCTTCAGCGGC---GATGTGCAGAACAAGTTAAAGGAATCCGCTCAGTGTGTGGGAGATGAATTCATGAATTGC
--D--V--V--L--K--L--F--L--S--F--S--G-----D--V--Q--N--K--L--K--E--S--A--Q--C--V--G--D--E--F--M--N--C-

--------------------><------------------------------------------------------------------------------
-K--L--A--T--R--A--K--D--F--L--P--A--D--I--Q--A--Q--F--A--I--S--R--E--L--I--R--N--I--Y--N--S--F--H--
AAGCTGGCTACCAGGGCCAAGGACTTCCTCCCAGCTGACATCCAGGCTCAGTTTGCCATCAGCCGGGAGCTGATCCGGAACATCTACAATAGCTTTCACA
:::::::::.:. ::::::::::::::::::::::.:::::::::.: :::::.:::.::::::::::::::::.::.:::::::::::.::::::.:::
AAGCTGGCTGCTCGGGCCAAGGACTTCCTCCCAGCCGACATCCAGACGCAGTTCGCCGTCAGCCGGGAGCTGATTCGAAACATCTACAACAGCTTTTACA
-K--L--A--A--R--A--K--D--F--L--P--A--D--I--Q--T--Q--F--A--V--S--R--E--L--I--R--N--I--Y--N--S--F--Y--

---------------------------------------------------------------------------------><-----------------
K--L--R--D--R--A--E--R--I--A--S--R--A--I--D--N--A--A--D--L--L--I--F--G--K--E--L--S--A--I--G--S--D--T
AGCTTCGCGACAGGGCCGAGCGGATCGCATCGCGGGCCATCGACAATGCGGCAGATCTTCTCATATTCGGGAAGGAGCTAAGTGCAATAGGGTCTGACAC
::::::::::. :::::::::: :: :..::.::::::::::::::::: :: ::.:: :::.:.::::::::::::      ::  :::::::::::::
AGCTTCGCGATCGGGCCGAGCGCATGGTGTCACGGGCCATCGACAATGCTGCCGACCTGCTCGTGTTCGGGAAGGAG------GCTTTAGGGTCTGACAC
K--L--R--D--R--A--E--R--M--V--S--R--A--I--D--N--A--A--D--L--L--V--F--G--K--E--------A--L--G--S--D--T

----------------------------------------------------------------------------------------------------
--T--P--L--P--S--W--A--A--L--N--S--S--T--W--G--S--L--K--Q--A--L--K--G--L--S--V--E--F--A--L--L--A--D-
GACCCCGCTGCCCTCCTGGGCCGCTCTGAATAGCAGCACGTGGGGGTCCCTGAAGCAGGCTCTGAAAGGCCTGTCTGTGGAATTCGCGCTGCTCGCCGAC
::::::::: ::::::::::::::::::::.:::::::::::::::::::: :::::::: ::::::::::::::::: :::::.::.::::::::.:::
GACCCCGCTCCCCTCCTGGGCCGCTCTGAACAGCAGCACGTGGGGGTCCCTCAAGCAGGCGCTGAAAGGCCTGTCTGTCGAATTTGCACTGCTCGCTGAC
--T--P--L--P--S--W--A--A--L--N--S--S--T--W--G--S--L--K--Q--A--L--K--G--L--S--V--E--F--A--L--L--A--D-

--------------><-------------------------------------------------------------------><---------------
-K--A--A--Q--Q--G--K--Q--E--E--N--D--V--V--E--K--L--N--L--F--L--D--L--L--Q--S--Y--K--D--L--C--E--R--
AAGGCTGCACAACAGGGTAAGCAGGAAGAGAACGACGTGGTGGAGAAGCTGAACCTCTTCTTGGATCTGCTGCAGTCCTATAAGGACCTGTGCGAGCGGC
:::::::::::.:::::.::.:::::.:::::::::::::::::::::::::.:::::::.:::::.:::: ::::::::.   ::::::::::::::::
AAGGCTGCACAGCAGGGCAAACAGGAGGAGAACGACGTGGTGGAGAAGCTGAGCCTCTTCCTGGATTTGCTCCAGTCCTAC---GACCTGTGCGAGCGGC
-K--A--A--Q--Q--G--K--Q--E--E--N--D--V--V--E--K--L--S--L--F--L--D--L--L--Q--S--Y-----D--L--C--E--R--

----------------------------------------------------------------------------------------------------
H--E--K--G--V--L--H--K--H--Q--R--A--L--H--K--Y--S--L--M--K--R--Q--M--M--S--A--T--A--Q--N--R--E--P--E
ATGAGAAGGGCGTGTTGCACAAGCACCAGCGGGCCCTGCACAAGTACAGCCTGATGAAGAGGCAGATGATGAGCGCCACCGCGCAGAACCGCGAGCCGGA
:.::::::::::: .::::::::::::::::::: ::::::::::::::::::::::::::::::::::::::::: .:::.::::::::::::::: ::
ACGAGAAGGGCGTCCTGCACAAGCACCAGCGGGCGCTGCACAAGTACAGCCTGATGAAGAGGCAGATGATGAGCGCGGCCGTGCAGAACCGCGAGCCCGA
H--E--K--G--V--L--H--K--H--Q--R--A--L--H--K--Y--S--L--M--K--R--Q--M--M--S--A--A--V--Q--N--R--E--P--E

---------------------------------><-----------------------------------------------------------------
--S--V--E--Q--L--E--S--R--I--V--E--Q--E--N--A--I--Q--T--M--E--L--R--N--Y--F--S--L--Y--C--L--H--Q--E-
GTCCGTGGAGCAGCTGGAGTCCCGCATTGTGGAGCAGGAGAACGCGATTCAGACGATGGAGCTGCGGAACTACTTCTCCCTGTACTGCCTGCACCAGGAG
:::::::::::::::::::::::::::.::::::::::::::::.:::.:::::::::::::: ::.:::::::::::::::::::::::::::::::::
GTCCGTGGAGCAGCTGGAGTCCCGCATCGTGGAGCAGGAGAACGTGATCCAGACGATGGAGCTCCGAAACTACTTCTCCCTGTACTGCCTGCACCAGGAG
--S--V--E--Q--L--E--S--R--I--V--E--Q--E--N--V--I--Q--T--M--E--L--R--N--Y--F--S--L--Y--C--L--H--Q--E-

-----------------------------------------------------------------------------------><---------------
-T--Q--L--I--H--V--Y--L--P--L--T--S--H--I--L--R--A--F--V--N--S--Q--I--Q--G--H--K--E--M--S--K--V--W--
ACGCAGCTCATCCACGTCTACCTGCCCCTCACCTCCCACATCCTCCGCGCCTTCGTCAACTCTCAGATCCAAGGGCACAAGGAGATGAGCAAGGTGTGGA
:::::::: .:::::::::::::::: :::::::::::::::::: ::::::::::::::::.::::::::::: ::::::::::::::.::::::::::
ACGCAGCTGGTCCACGTCTACCTGCCGCTCACCTCCCACATCCTCGGCGCCTTCGTCAACTCCCAGATCCAAGGCCACAAGGAGATGAGTAAGGTGTGGA
-T--Q--L--V--H--V--Y--L--P--L--T--S--H--I--L--G--A--F--V--N--S--Q--I--Q--G--H--K--E--M--S--K--V--W--

------------------------------------------------------------------------------------------------->
N--D--L--R--P--K--L--S--C--L--F--A--G--P--H--S--T--L--T--P--P--C--S--P--P--E--D--G--L--C--P--H--*-
ACGACCTGAGGCCCAAGCTCAGCTGCCTCTTTGCGGGACCACACAGCACCCTGACCCCACCGTGCTCCCCGCCGGAGGACGGCCTGTGTCCTCACTAG
:::::::: .:::::::::: .:::::::::.:: :::::::::.:..:::.:::::::::: : :::   ::: .::::::::..: ::::::::::
ACGACCTGCAGCCCAAGCTCCACTGCCTCTTCGCTGGACCACACGGTGCCCCGACCCCACCGAGGTCC---CCGCGGGACGGCCCATCTCCTCACTAG
N--D--L--Q--P--K--L--H--C--L--F--A--G--P--H--G--A--P--T--P--P--R--S-----P--R--D--G--P--S--P--H--*-

Pig Consensus Sequence

>BGISUST0000892773
----------------------------------------------------------------------------------------------------
-----CCCCAGGTCAGTGAGCCGACGGCCCTGGACTCCAGTCGGATGCAGATGCCGCCGGGGAACCCGCTGCTGCTGTCGCTCACGCTGCAGGAGCTGCT
GGCCCGCGACGCCGTGCAGGTGGAGCTCATCCCTGAGAAGAAGGGCCTCTTCCTGAAGCACGTGGAGTATGAGGTTTCCAGCCAGCGCTTCAAGTCGTCC
GTGTACCGACGGTACAATGACTTTGTGGTCTTCCACGAGATGCTGCTGCAGAAGTTCCCGTACCGCATGGTGCCAGCCCTTCCGCCCAAGAGGATGCTGG
GA---GACAGGGAGTTCATCGAGGCGCGGAGGAGAGCCCTGAAGCGCTTCATCAACCTGGTGGCCCGGCACCCGCCCTTCTCCGAGGACGTCGTGCTCAA
GCTCTTCCTGTCCTTCAGCGGC---GATGTGCAGAACAAGTTAAAGGAATCCGCTCAGTGTGTGGGAGATGAATTCATGAATTGCAAGCTGGCTGCTCGG
GCCAAGGACTTCCTCCCAGCCGACATCCAGACGCAGTTCGCCGTCAGCCGGGAGCTGATTCGAAACATCTACAACAGCTTTTACAAGCTTCGCGATCGGG
CCGAGCGCATGGTGTCACGGGCCATCGACAATGCTGCCGACCTGCTCGTGTTCGGGAAGGAG------GCTTTAGGGTCTGACACGACCCCGCTCCCCTC
CTGGGCCGCTCTGAACAGCAGCACGTGGGGGTCCCTCAAGCAGGCGCTGAAAGGCCTGTCTGTCGAATTTGCACTGCTCGCTGACAAGGCTGCACAGCAG
GGCAAACAGGAGGAGAACGACGTGGTGGAGAAGCTGAGCCTCTTCCTGGATTTGCTCCAGTCCTAC---GACCTGTGCGAGCGGCACGAGAAGGGCGTCC
TGCACAAGCACCAGCGGGCGCTGCACAAGTACAGCCTGATGAAGAGGCAGATGATGAGCGCGGCCGTGCAGAACCGCGAGCCCGAGTCCGTGGAGCAGCT
GGAGTCCCGCATCGTGGAGCAGGAGAACGTGATCCAGACGATGGAGCTCCGAAACTACTTCTCCCTGTACTGCCTGCACCAGGAGACGCAGCTGGTCCAC
GTCTACCTGCCGCTCACCTCCCACATCCTCGGCGCCTTCGTCAACTCCCAGATCCAAGGCCACAAGGAGATGAGTAAGGTGTGGAACGACCTGCAGCCCA
AGCTCCACTGCCTCTTCGCTGGACCACACGGTGCCCCGACCCCACCGAGGTCCCCGCGGGACGGCCCATCTCCTCACTAG


>BGISUSP0000892773
-----------------------------------PQVSEPTALDSSRMQMPPGNPLLLSLTLQELLARDAVQVELIPEKKGLFLKHVEYEVSSQRFKSS
VYRRYNDFVVFHEMLLQKFPYRMVPALPPKRMLG-DREFIEARRRALKRFINLVARHPPFSEDVVLKLFLSFSG-DVQNKLKESAQCVGDEFMNCKLAAR
AKDFLPADIQTQFAVSRELIRNIYNSFYKLRDRAERMVSRAIDNAADLLVFGKE--ALGSDTTPLPSWAALNSSTWGSLKQALKGLSVEFALLADKAAQQ
GKQEENDVVEKLSLFLDLLQSY-DLCERHEKGVLHKHQRALHKYSLMKRQMMSAAVQNREPESVEQLESRIVEQENVIQTMELRNYFSLYCLHQETQLVH
VYLPLTSHILGAFVNSQIQGHKEMSKVWNDLQPKLHCLFAGPHGAPTPPRSPRDGPSPH*