Sequences
EST Library Info
ebs1Foetus 50 days, brain stem
pigca1Unavailable
pldo1Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000197162 (click for geneview)
Transcript ID ENST00000223459(link to ensembl)
Symbol NP_660314.1
Localtion Chromosome:16:30488554:30491556:-1 band: 16p11.2
Description similar to hypothetical protein MGC13138
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--P--P--P--A--P--L--L--A--P--R--P--G--E--T--R--P--G--C--R--K--P--G--T--V--S--F--A--D--V--A--V--
ATGGCGCCGCCCCCAGCCCCGCTCCTGGCGCCGAGGCCCGGGGAGACCCGGCCTGGTTGCAGGAAGCCCGGGACTGTGAGCTTCGCGGACGTGGCCGTGT
:::::::::::.::.:::: :::::.::.::.:::.:: ::::: ::. :::: :::::::.:::::::: :.:.::::: :::::::::::::::::::
ATGGCGCCGCCTCCGGCCCGGCTCCCGGTGCTGAGACCGGGGGATACTGGGCCGGGTTGCAAGAAGCCCGCGGCCGTGAGGTTCGCGGACGTGGCCGTGT
-M--A--P--P--P--A--R--L--P--V--L--R--P--G--D--T--G--P--G--C--K--K--P--A--A--V--R--F--A--D--V--A--V--

-----------------------------------------------------------------------------------------------><---
Y--F--S--P--E--E--W--G--C--L--R--P--A--Q--R--A--L--Y--R--D--V--M--Q--E--T--Y--G--H--L--G--A--L--G--F
ACTTCTCCCCGGAGGAGTGGGGCTGTCTGCGGCCCGCGCAGAGGGCTCTGTACCGGGACGTGATGCAGGAGACCTACGGCCACCTGGGCGCGCTCGGATT
:.:::::::::::::::::::: :::::::::::::::::::::::.:::::::::::::::::::.::::::::::::::::::::::::::::   ::
ATTTCTCCCCGGAGGAGTGGGGGTGTCTGCGGCCCGCGCAGAGGGCCCTGTACCGGGACGTGATGCGGGAGACCTACGGCCACCTGGGCGCGCTC---TT
Y--F--S--P--E--E--W--G--C--L--R--P--A--Q--R--A--L--Y--R--D--V--M--R--E--T--Y--G--H--L--G--A--L-----F

----------------------------------------------------------------------------------------------------
--P--G--P--K--P--A--L--I--S--W--M--E--Q--E--S--E--A--W--S--P--A--A--Q--D--P--E--K--G--E--R--L--G--G-
CCCAGGCCCCAAACCAGCCCTCATCTCTTGGATGGAACAGGAGAGTGAGGCTTGGAGCCCCGCCGCCCAGGATCCTGAGAAGGGGGAAAGACTGGGAGGA
:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::: :::::::::
CCCAGGCCCCAAACCAGCCCTCATCTCTTGGATGGAACAGGAGAGTGAGGCTTGGAGCCCCGCCGCCCAGGATCCTGAGGAGGGGGAAAGCCTGGGAGGA
--P--G--P--K--P--A--L--I--S--W--M--E--Q--E--S--E--A--W--S--P--A--A--Q--D--P--E--E--G--E--S--L--G--G-

---------><-----------------------------------------------------------------------------------------
-A--R--R--G--D--V--P--N--R--K--E--E--E--P--E--E--V--P--R--A--K--G--P--R--K--A--P--V--K--E--S--P--E--
GCTCGGAGAGGAGATGTCCCAAACAGGAAGGAAGAGGAACCGGAGGAAGTCCCAAGAGCCAAAGGGCCTAGAAAGGCTCCTGTGAAGGAGAGTCCTGAAG
 ::: ::::   ::::.: ::::. ..:::::::: ::::: :::: ::  :::.::::::::::.::.::::::.: .:.: .:::::::: :: ::::
CCTCTGAGA---GATGCCGCAAATCAAAAGGAAGATGAACCCGAGGCAGGGCCAGGAGCCAAAGGACCCAGAAAGACGTCCGGAAAGGAGAGGCCGGAAG
-P--L--R-----D--A--A--N--Q--K--E--D--E--P--E--A--G--P--G--A--K--G--P--R--K--T--S--G--K--E--R--P--E--

----------------------------------------------------------------------------------------------------
V--L--V--E--R--N--P--D--P--A--I--S--V--A--P--A--R--A--Q--P--P--K--N--A--A--W--D--P--T--T--G--A--Q--P
TGCTGGTGGAACGCAACCCTGACCCAGCTATTAGCGTGGCCCCGGCACGGGCACAGCCACCCAAAAATGCTGCCTGGGACCCGACCACAGGAGCACAGCC
 :::::: .:::.:: ::: :::.:..:.::.:::. ..::.::::  :.:::::: ::::::..::.::::: .:::::: :: :::::: ::.:::::
AGCTGGTTAAACACACCCCGGACTCGACCATCAGCAAAACCTCGGCCAGAGCACAGACACCCAGGAACGCTGCGCGGGACCAGAGCACAGGTGCGCAGCC
E--L--V--K--H--T--P--D--S--T--I--S--K--T--S--A--R--A--Q--T--P--R--N--A--A--R--D--Q--S--T--G--A--Q--P

----------------------------------------------------------------------------------------------------
--P--A--P--I--P--S--------M--D--A--Q--A--G--Q--R--R--H--V--C--T--D--C--G--R--R--F--T--Y--P--S--L--L-
CCCGGCACCCATACCCAGC------ATGGATGCTCAGGCCGGCCAGCGGCGCCACGTGTGCACGGACTGCGGCCGCCGCTTCACCTACCCCTCACTGCTG
:::::. :: .: :::.::      .::::::::::::::.::::::::::::::::::::.:::::::::::::::::::::::::::: ::.::::::
CCCGGTCCCGGTCCCCGGCGGCGGCGTGGATGCTCAGGCCAGCCAGCGGCGCCACGTGTGCGCGGACTGCGGCCGCCGCTTCACCTACCCGTCGCTGCTG
--P--V--P--V--P--G--G--G--V--D--A--Q--A--S--Q--R--R--H--V--C--A--D--C--G--R--R--F--T--Y--P--S--L--L-

----------------------------------------------------------------------------------------------------
-V--S--H--R--R--M--H--S--G--E--R--P--F--P--C--P--E--C--G--M--R--F--K--R--K--F--A--V--E--A--H--Q--W--
GTCAGCCACAGGCGCATGCACTCGGGGGAGCGGCCTTTCCCCTGCCCCGAGTGTGGCATGCGCTTCAAGAGGAAGTTCGCAGTGGAAGCGCACCAGTGGA
::::::::: ::::::::::::: :: ::::::::.:::::::::::::::::::::::::::::::::::::::::::: :::::::::::::::::::
GTCAGCCACCGGCGCATGCACTCCGGCGAGCGGCCCTTCCCCTGCCCCGAGTGTGGCATGCGCTTCAAGAGGAAGTTCGCCGTGGAAGCGCACCAGTGGA
-V--S--H--R--R--M--H--S--G--E--R--P--F--P--C--P--E--C--G--M--R--F--K--R--K--F--A--V--E--A--H--Q--W--

----------------------------------------------------------------------------------------------------
I--H--R--S--C--S--G--G--R--R--G--R--R--P--G--I--R--A--V--P--R--A--P--V--R--G--D--R--D--P--P--V--L--F
TCCACCGCTCCTGCTCCGGGGGGCGGCGGGGCCGGAGGCCTGGGATCCGGGCTGTGCCTCGGGCCCCCGTCCGAGGTGACCGGGACCCGCCTGTGCTCTT
::::::::::::::::.:: ::::::::::::::::::::::::::::::::::::::::::::::: ::::::::::::::::::::::: ::::: ::
TCCACCGCTCCTGCTCTGGCGGGCGGCGGGGCCGGAGGCCTGGGATCCGGGCTGTGCCTCGGGCCCCGGTCCGAGGTGACCGGGACCCGCCAGTGCTGTT
I--H--R--S--C--S--G--G--R--R--G--R--R--P--G--I--R--A--V--P--R--A--P--V--R--G--D--R--D--P--P--V--L--F

------------------------------------>
--R--H--Y--P--D--I--F--E--E--C--G--*-
CCGGCACTACCCAGACATCTTCGAGGAGTGCGGCTGA
::: ::::::::.::::::::::::::::::::::::
CCGCCACTACCCGGACATCTTCGAGGAGTGCGGCTGA
--R--H--Y--P--D--I--F--E--E--C--G--*-

Pig Consensus Sequence

>BGISUST0000891859
ATGGCGCCGCCTCCGGCCCGGCTCCCGGTGCTGAGACCGGGGGATACTGGGCCGGGTTGCAAGAAGCCCGCGGCCGTGAGGTTCGCGGACGTGGCCGTGT
ATTTCTCCCCGGAGGAGTGGGGGTGTCTGCGGCCCGCGCAGAGGGCCCTGTACCGGGACGTGATGCGGGAGACCTACGGCCACCTGGGCGCGCTC---TT
CCCAGGCCCCAAACCAGCCCTCATCTCTTGGATGGAACAGGAGAGTGAGGCTTGGAGCCCCGCCGCCCAGGATCCTGAGGAGGGGGAAAGCCTGGGAGGA
CCTCTGAGA---GATGCCGCAAATCAAAAGGAAGATGAACCCGAGGCAGGGCCAGGAGCCAAAGGACCCAGAAAGACGTCCGGAAAGGAGAGGCCGGAAG
AGCTGGTTAAACACACCCCGGACTCGACCATCAGCAAAACCTCGGCCAGAGCACAGACACCCAGGAACGCTGCGCGGGACCAGAGCACAGGTGCGCAGCC
CCCGGTCCCGGTCCCCGGCGGCGGCGTGGATGCTCAGGCCAGCCAGCGGCGCCACGTGTGCGCGGACTGCGGCCGCCGCTTCACCTACCCGTCGCTGCTG
GTCAGCCACCGGCGCATGCACTCCGGCGAGCGGCCCTTCCCCTGCCCCGAGTGTGGCATGCGCTTCAAGAGGAAGTTCGCCGTGGAAGCGCACCAGTGGA
TCCACCGCTCCTGCTCTGGCGGGCGGCGGGGCCGGAGGCCTGGGATCCGGGCTGTGCCTCGGGCCCCGGTCCGAGGTGACCGGGACCCGCCAGTGCTGTT
CCGCCACTACCCGGACATCTTCGAGGAGTGC


>BGISUSP0000891859
MAPPPARLPVLRPGDTGPGCKKPAAVRFADVAVYFSPEEWGCLRPAQRALYRDVMRETYGHLGAL-FPGPKPALISWMEQESEAWSPAAQDPEEGESLGG
PLR-DAANQKEDEPEAGPGAKGPRKTSGKERPEELVKHTPDSTISKTSARAQTPRNAARDQSTGAQPPVPVPGGGVDAQASQRRHVCADCGRRFTYPSLL
VSHRRMHSGERPFPCPECGMRFKRKFAVEAHQWIHRSCSGGRRGRRPGIRAVPRAPVRGDRDPPVLFRHYPDIFEEC