Sequences
EST Library Info
cki1Kidney - RNA from China
eru2Foetus 50 days, regio umbilicalis
fcc1Unavailable
pigca8Unavailable
pigcb2Unavailable
spl2Spleen
ssp1M. Supraspinatus
ton3Tip of tongue, mucosal membrane
Clusters
Oligos
SNPs

Gene ID ENSG00000107104 (click for geneview)
Transcript ID ENST00000223950(link to ensembl)
Symbol ANR15_HUMAN
Localtion Chromosome:9:494716:736102:1 band: 9p24.3
Description Ankyrin repeat domain protein 15 (Kidney ankyrin repeat-containing protein).
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--E--T--R--R--R--L--E--Q--E--R--A--T--M--Q--M--T--P--G--E--F--R--R--P--R--L--A--S--F--G--G--M--G--
ATGGAGACCCGGAGAAGACTGGAACAGGAGAGAGCCACCATGCAGATGACACCGGGTGAGTTCAGAAGGCCCAGGCTGGCCAGTTTTGGAGGCATGGGCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
T--T--S--S--L--P--S--F--V--G--S--G--N--H--N--P--A--K--H--Q--L--Q--N--G--Y--Q--G--N--G--D--Y--G--S--Y
CCACAAGCTCCCTCCCTTCTTTTGTGGGTTCTGGAAACCACAATCCTGCCAAGCACCAGCTTCAGAATGGATACCAAGGTAATGGGGATTATGGTAGCTA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--A--P--A--A--P--T--T--S--S--M--G--S--S--I--R--H--S--P--L--S--S--G--I--S--T--P--V--T--N--V--S--P--M-
TGCCCCAGCTGCTCCCACCACTTCCTCCATGGGGAGCTCCATCCGCCACAGCCCCCTGAGCTCAGGGATCTCCACCCCAGTGACCAACGTGAGCCCCATG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-H--L--Q--H--I--R--E--Q--M--A--I--A--L--K--R--L--K--E--L--E--E--Q--V--R--T--I--P--V--L--Q--V--K--I--
CACCTGCAGCACATCCGCGAGCAGATGGCCATTGCTCTGAAACGCCTGAAGGAGCTGGAGGAGCAGGTGCGAACCATCCCTGTGCTCCAGGTAAAGATCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
S--V--L--Q--E--E--K--R--Q--L--V--S--Q--L--K--N--Q--R--A--A--S--Q--I--N--V--C--G--V--R--K--R--S--Y--S
CTGTCTTGCAAGAAGAGAAAAGGCAGTTGGTCTCACAGCTGAAAAACCAAAGGGCTGCATCCCAGATCAATGTCTGTGGTGTGAGGAAGCGGTCCTATAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--A--G--N--A--S--Q--L--E--Q--L--S--R--A--R--R--S--G--G--E--L--Y--I--D--Y--E--E--E--E--M--E--T--V--E-
TGCGGGGAACGCCTCCCAGCTGGAACAGCTCTCCCGGGCCCGAAGAAGTGGCGGGGAATTATACATTGACTATGAGGAGGAAGAAATGGAGACCGTAGAA
                                           ::::::::.:::::.::::::::::::::::::::::::::.::::::: .::.::.
-------------------------------------------AGAAGTGGTGGGGAGTTATACATTGACTATGAGGAGGAAGAGATGGAGAGTGTGGAG
--------------------------------------------R--S--G--G--E--L--Y--I--D--Y--E--E--E--E--M--E--S--V--E-

----------------------------------------------------------------------------------------------------
-Q--S--T--Q--R--I--K--E--F--R--Q--L--T--A--D--M--Q--A--L--E--Q--K--I--Q--D--S--S--C--E--A--S--S--E--
CAGAGCACGCAGAGGATAAAGGAGTTCCGGCAACTTACAGCAGACATGCAAGCCCTGGAGCAGAAGATCCAGGACAGCAGCTGTGAGGCCTCCTCAGAGC
::::::::.::: :::::::::::::::::::.::.::::::::::::::::::::::::::::::::::::::.:::::::.::::::.::::::::: 
CAGAGCACACAGCGGATAAAGGAGTTCCGGCAGCTCACAGCAGACATGCAAGCCCTGGAGCAGAAGATCCAGGATAGCAGCTATGAGGCTTCCTCAGAGG
-Q--S--T--Q--R--I--K--E--F--R--Q--L--T--A--D--M--Q--A--L--E--Q--K--I--Q--D--S--S--Y--E--A--S--S--E--

----------------------------------------------------------------------------------------------------
L--R--E--N--G--E--C--R-----------------S--V--A--V--G--A--E--E--N--M--N--D--I--V--V--Y--H--R--G--S--R
TCAGGGAGAATGGAGAGTGCCGG---------------TCTGTGGCTGTGGGTGCCGAGGAGAACATGAACGACATCGTCGTGTACCACAGAGGCTCCAG
::::::::::.::.:::::.::.               ::::::::::::::.:::.: :::::::::.:::::::.::::::::.:::::.::. ::::
TCAGGGAGAACGGGGAGTGTCGACCTCGAGAATGCCGGTCTGTGGCTGTGGGCGCCAACGAGAACATGGACGACATTGTCGTGTATCACAGGGGTGCCAG
V--R--E--N--G--E--C--R--P--R--E--C--R--S--V--A--V--G--A--N--E--N--M--D--D--I--V--V--Y--H--R--G--A--R

----------------------------------------------------------------------------------------------------
--S--C--K--D--A--A--V--G--T--L--V--E--M--R--N--C--G--V--S--V--T--E--A--M--L--G--V--M--T--E--A--D--K-
GTCCTGTAAGGATGCAGCTGTAGGGACACTTGTTGAGATGAGAAATTGTGGGGTCAGCGTGACAGAGGCCATGCTTGGAGTGATGACTGAAGCTGACAAA
:::.:::::::::::  ::::::::::: :...:::::..::.:::: :::::::::::::::::::::::::::::::::::. ::::::::::::::.
GTCTTGTAAGGATGCCTCTGTAGGGACAGTCACTGAGACAAGGAATTCTGGGGTCAGCGTGACAGAGGCCATGCTTGGAGTGACCACTGAAGCTGACAAG
--S--C--K--D--A--S--V--G--T--V--T--E--T--R--N--S--G--V--S--V--T--E--A--M--L--G--V--T--T--E--A--D--K-

----------------------------------------------------------------------------------------------------
-E--I--E--L--Q--Q--Q--T--I--E--S--L--K--E--K--I--Y--R--L--E--V--Q--L--R--E--T--T--H--D--R--E--M--T--
GAAATTGAGCTGCAACAGCAGACCATAGAATCCTTGAAGGAAAAGATCTATCGCCTAGAAGTACAGCTTAGAGAAACCACCCATGACCGGGAGATGACTA
:::::::::::.::.:::::.::::::::: ::::.::::::::::::::.:::::.:::::.::::: :.:::::::::::::::::::::::::::::
GAAATTGAGCTACAGCAGCAAACCATAGAAGCCTTAAAGGAAAAGATCTACCGCCTGGAAGTGCAGCTGAAAGAAACCACCCATGACCGGGAGATGACTA
-E--I--E--L--Q--Q--Q--T--I--E--A--L--K--E--K--I--Y--R--L--E--V--Q--L--K--E--T--T--H--D--R--E--M--T--

----------------------------------------------------------------------------------------------------
K--L--K--Q--E--L--Q--A--A--G--S--R--K--K--V--D--K--A--T--M--A--Q--P--L--V--F--S--K--V--V--E--A--V--V
AACTGAAACAAGAGCTGCAGGCTGCTGGATCGAGGAAAAAGGTTGACAAAGCCACGATGGCCCAGCCGCTTGTTTTCAGTAAGGTGGTGGAGGCAGTGGT
:::: ::.:::::::::::.::::::::::::::::::::.::::::::::::..:::::::::: :.:::::::::::.:::.::::::::::.:::::
AACTCAAGCAAGAGCTGCAAGCTGCTGGATCGAGGAAAAAAGTTGACAAAGCCGTGATGGCCCAGACACTTGTTTTCAGCAAGATGGTGGAGGCGGTGGT
K--L--K--Q--E--L--Q--A--A--G--S--R--K--K--V--D--K--A--V--M--A--Q--T--L--V--F--S--K--M--V--E--A--V--V

----------------------------------------------------------------------------------------------------
--Q--T--R--D--Q--M--V--G--S--H--M--D--L--V--D--T--C--V--G--T--S--V--E--T--N--S--V--G--I--S--C--Q--P-
GCAGACCAGAGACCAAATGGTCGGCAGTCACATGGACCTGGTGGACACGTGTGTTGGGACCTCCGTGGAAACAAACAGTGTAGGCATCTCCTGCCAGCCT
.: ::. ::::::::.::::..:::::::::.::::: :::: :::::.::::: ::::::: :.:. :.:::::.::. :.::::::            
ACTGATGAGAGACCAGATGGCTGGCAGTCACGTGGACGTGGTTGACACATGTGTGGGGACCTGCATACAGACAAATAGCTTGGGCATC------------
--L--M--R--D--Q--M--A--G--S--H--V--D--V--V--D--T--C--V--G--T--C--I--Q--T--N--S--L--G--I-------------

----------------------------------------------------------------------------------------------------
-E--C--K--N--K--V--V--G--P--E--L--P--M--N--W--W--I--V--K--E--R--V--E--M--H--D--R--C--A--G--R--S--V--
GAATGTAAGAATAAAGTCGTAGGGCCTGAGCTGCCTATGAATTGGTGGATTGTTAAGGAGAGGGTGGAAATGCATGACCGATGTGCTGGGAGGTCTGTGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
E--M--C--D--K--S--V--S--V--E--V--S--V--C--E--T--G--S--N--T--E--E--S--V--N--D--L--T--L--L--K--T--N--L
AAATGTGTGACAAGAGTGTGAGTGTGGAAGTCAGCGTCTGCGAAACAGGCAGCAACACAGAGGAGTCTGTGAACGACCTCACACTCCTCAAGACAAACTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--N--L--K--E--V--R--S--I--G--C--G--D--C--S--V--D--V--T--V--C--S--P--K--E--C--A--S--R--G--V--N--T--E-
GAATCTCAAAGAAGTGCGGTCTATCGGTTGTGGAGATTGTTCTGTTGACGTGACCGTCTGCTCTCCAAAGGAGTGCGCCTCCCGGGGCGTGAACACTGAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-A--V--S--Q--V--E--A--A--V--M--A--V--P--R--T--A--D--Q--D--T--S--T--D--L--E--Q--V--H--Q--F--T--N--T--
GCTGTTAGCCAGGTGGAAGCTGCCGTCATGGCAGTGCCTCGTACTGCAGACCAGGACACTAGCACAGATTTGGAACAGGTGCACCAGTTCACCAACACCG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
E--T--A--T--L--I--E--S--C--T--N--T--C--L--S--T--L--D--K--Q--T--S--T--Q--T--V--E--T--R--T--V--A--V--G
AGACGGCCACCCTCATAGAGTCCTGCACCAACACTTGTCTAAGCACTTTGGACAAGCAGACCAGCACCCAGACTGTGGAGACGCGGACAGTAGCTGTAGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--E--G--R--V--K--D--I--N--S--S--T--K--T--R--S--I--G--V--G--T--L--L--S--G--H--S--G--F--D--R--P--S--A-
AGAAGGCCGTGTCAAGGACATCAACTCCTCCACCAAGACGCGGTCCATTGGTGTTGGAACGTTGCTTTCTGGCCATTCTGGGTTTGACAGGCCATCAGCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-V--K--T--K--E--S--G--V--G--Q--I--N--I--N--D--N--Y--L--V--G--L--K--M--R--T--I--A--C--G--P--P--Q--L--
GTGAAGACCAAAGAGTCAGGTGTGGGGCAGATAAATATTAACGACAACTATCTGGTTGGTCTCAAAATGAGGACTATAGCTTGTGGGCCACCACAGTTGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
T--V--G--L--T--A--S--R--R--S--V--G--V--G--D--D--P--V--G--E--S--L--E--N--P--Q--P--Q--A--P--L--G--M--M
CTGTGGGGCTGACAGCCAGCAGAAGGAGCGTGGGGGTTGGGGATGACCCTGTAGGGGAATCTCTGGAGAACCCCCAGCCTCAAGCTCCACTTGGAATGAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--T--G--L--D--H--Y--I--E--R--I--Q--K--L--L--A--E--Q--Q--T--L--L--A--E--N--Y--S--E--L--A--E--A--F--G-
GACTGGCCTGGATCACTACATTGAGCGTATCCAGAAGCTGCTGGCAGAACAGCAGACACTGCTGGCTGAGAACTACAGTGAACTGGCAGAAGCTTTCGGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-E--P--H--S--Q--M--G--S--L--N--S--Q--L--I--S--T--L--S--S--I--N--S--V--M--K--S--A--S--T--E--E--L--R--
GAACCTCACTCACAGATGGGCTCCCTCAACTCTCAGCTCATCAGCACCCTGTCGTCTATCAACTCTGTCATGAAATCTGCAAGCACTGAAGAGCTGAGGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------><------------------------------------------------------------
N--P--D--F--Q--K--T--S--L--G--K--I--T--G--N--Y--L--G--Y--T--C--K--C--G--G--L--Q--S--G--S--P--L--S--S
ACCCTGACTTCCAGAAAACCAGTCTGGGTAAAATCACAGGCAATTATTTGGGATATACCTGTAAGTGTGGGGGCCTTCAGTCAGGAAGTCCCTTAAGCTC
                                         :.: ::::::.::::::::::::::::::..:::::::::::.::.: :: ::::.:.:
-----------------------------------------AGTAATTTGGAATATACCTGTAAGTGTGGAAGCCTTCAGTCAAGAGGACCATTAAACCC
------------------------------------------S--N--L--E--Y--T--C--K--C--G--S--L--Q--S--R--G--P--L--N--P

----------------------------------------------------------------------------------------------------
--Q--T--S--Q--P--E--Q--E--V--G--T--S--E--G--K--P--I--S--S--L--D--A--F--P--T--Q--E--G--T--L--S--P--V-
CCAGACATCCCAGCCTGAGCAAGAAGTGGGGACCTCAGAAGGAAAGCCAATCAGCAGCCTGGATGCCTTCCCCACTCAGGAAGGTACGCTGTCTCCAGTG
:::::::::::::: :::::::::.::::::::: :.:::::.::::: ::::::.::: ::::.:::::::: ::::::::. .::..::::: :::::
CCAGACATCCCAGCATGAGCAAGAGGTGGGGACCACGGAAGGGAAGCCCATCAGCGGCCAGGATACCTTCCCCCCTCAGGAAACCACATTGTCTGCAGTG
--Q--T--S--Q--H--E--Q--E--V--G--T--T--E--G--K--P--I--S--G--Q--D--T--F--P--P--Q--E--T--T--L--S--A--V-

------------------------------------><--------------------------------------------------------------
-N--L--T--D--D--Q--I--A--A--G--L--Y--A--C--T--N--N--E--S--T--L--K--S--I--M--K--K--K--D--G--N--K--D--
AACCTGACAGACGACCAGATCGCCGCTGGCCTCTATGCATGTACAAACAATGAAAGTACACTGAAGTCCATCATGAAGAAGAAAGATGGTAACAAAGATT
:::::::::::.:::::::: :::::::::::::::   ::::::::.::.::::::::::::::::::::::::::::::::::::: .::::::::::
AACCTGACAGATGACCAGATAGCCGCTGGCCTCTAT---TGTACAAATAACGAAAGTACACTGAAGTCCATCATGAAGAAGAAAGATGCCAACAAAGATT
-N--L--T--D--D--Q--I--A--A--G--L--Y-----C--T--N--N--E--S--T--L--K--S--I--M--K--K--K--D--A--N--K--D--

---------------------------------------------><-----------------------------------------------------
S--N--G--A--K--K--N--L--Q--F--V--G--I--N--G--G--Y--E--T--T--S--S--D--D--S--S--S--D--E--S--S--S--S--E
CAAATGGCGCAAAAAAGAATCTTCAGTTTGTTGGCATTAATGGAGGGTATGAAACAACTTCAAGTGATGATTCCAGCTCAGATGAAAGCTCTTCTTCCGA
::::::: ::.::.::::::::::::::::::::::::::::::   :::::::::::::::::::::: :::::::::::: :::::::::::::::::
CAAATGGAGCGAAGAAGAATCTTCAGTTTGTTGGCATTAATGGA---TATGAAACAACTTCAAGTGATGCTTCCAGCTCAGAGGAAAGCTCTTCTTCCGA
S--N--G--A--K--K--N--L--Q--F--V--G--I--N--G-----Y--E--T--T--S--S--D--A--S--S--S--E--E--S--S--S--S--E

----------------------------------------------------------------------------------------------------
--S--D--D--E--C--D--V--I--E--Y--P--L--E--E--E--E--E--E--E--D--E--D-----T--R--G--M--A--E--G--H--H--A-
GTCAGATGACGAGTGTGATGTCATTGAGTATCCTCTTGAAGAAGAGGAGGAGGAGGAGGATGAAGAC---ACTCGGGGAATGGCAGAAGGGCACCATGCA
:::::::::::::::::::::: .::: :.:::::.:::.::::::::::::::.::::: :: :.    ::::::::::::::.:::::::: :.::::
GTCAGATGACGAGTGTGATGTCCCTGACTGTCCTCCTGAGGAAGAGGAGGAGGAAGAGGAGGACGGAGTCACTCGGGGAATGGCGGAAGGGCAGCGTGCA
--S--D--D--E--C--D--V--P--D--C--P--P--E--E--E--E--E--E--E--E--D--G--V--T--R--G--M--A--E--G--Q--R--A-

----------------------------------------------------------------------------------------><----------
-V--N--I--E--G--L--K--S--A--R--V--E--D--E--M--Q--V--Q--E--C--E--P--E--K--V--E--I--R--E--R--Y--E--L--
GTTAATATTGAAGGTTTGAAGTCTGCCAGGGTGGAAGATGAAATGCAGGTTCAAGAATGTGAACCTGAGAAGGTGGAAATCAGAGAGAGGTATGAATTAA
::::::.: :::::::: :::::..::::::::::::::::::::::::::: ::::::::::::::::::::::::::::::::::   ::::::::::
GTTAATGTGGAAGGTTTCAAGTCCACCAGGGTGGAAGATGAAATGCAGGTTCCAGAATGTGAACCTGAGAAGGTGGAAATCAGAGAG---TATGAATTAA
-V--N--V--E--G--F--K--S--T--R--V--E--D--E--M--Q--V--P--E--C--E--P--E--K--V--E--I--R--E-----Y--E--L--

----------------------------------------------------------------------------><----------------------
S--E--K--M--L--S--A--C--N--L--L--K--N--T--I--N--D--P--K--A--L--T--S--K--D--M--R--F--C--L--N--T--L--Q
GTGAAAAGATGTTGTCTGCATGCAACTTACTGAAAAATACTATAAATGACCCCAAAGCTTTGACCAGCAAAGATATGAGGTTCTGTCTGAACACCCTCCA
::::::::::::::::::::::::::::::::::::::: ::::::::::::::.:::::::::::::::.:::::::::::::::::::::::.:::::
GTGAAAAGATGTTGTCTGCATGCAACTTACTGAAAAATAATATAAATGACCCCAGAGCTTTGACCAGCAAGGATATGAGGTTCTGTCTGAACACTCTCCA
S--E--K--M--L--S--A--C--N--L--L--K--N--N--I--N--D--P--R--A--L--T--S--K--D--M--R--F--C--L--N--T--L--Q

----------------------------------------------------------------------------------------------------
--H--E--W--F--R--V--S--S--Q--K--S--A--I--P--A--M--V--G--D--Y--I--A--A--F--E--A--I--S--P--D--V--L--R-
GCACGAGTGGTTCCGCGTGTCCAGTCAGAAGTCAGCCATTCCAGCCATGGTGGGGGACTACATAGCTGCTTTTGAGGCCATTTCCCCAGATGTCCTCCGC
:::.:::::::::::::::::::::::::::::::::::.::.:::::::::::::::::::: .:.::.::.::::::::.:::::::::::.::::::
GCATGAGTGGTTCCGCGTGTCCAGTCAGAAGTCAGCCATCCCGGCCATGGTGGGGGACTACATCACCGCCTTCGAGGCCATCTCCCCAGATGTTCTCCGC
--H--E--W--F--R--V--S--S--Q--K--S--A--I--P--A--M--V--G--D--Y--I--T--A--F--E--A--I--S--P--D--V--L--R-

------------------------------------------------------------------------------------------------><--
-Y--V--I--N--L--A--D--G--N--G--N--T--A--L--H--Y--S--V--S--H--S--N--F--E--I--V--K--L--L--L--D--A--D--
TATGTCATCAACTTGGCAGACGGCAACGGCAACACAGCCCTCCATTACAGCGTGTCCCACTCCAACTTCGAGATTGTGAAGCTGCTGTTAGATGCCGATG
.:..:::::::: :::::::.:::::.:::::::: ::::::::.:::::::::::::::::::::::.:::::.:: :::::::: ::.:::      :
CACATCATCAACATGGCAGATGGCAATGGCAACACCGCCCTCCACTACAGCGTGTCCCACTCCAACTTTGAGATCGTCAAGCTGCTCTTGGAT------G
-H--I--I--N--M--A--D--G--N--G--N--T--A--L--H--Y--S--V--S--H--S--N--F--E--I--V--K--L--L--L--D--------

----------------------------------------------------------------------------------------------------
V--C--N--V--D--H--Q--N--K--A--G--Y--T--P--I--M--L--A--A--L--A--A--V--E--A--E--K--D--M--R--I--V--E--E
TGTGTAATGTGGATCACCAGAACAAGGCAGGCTACACCCCCATCATGTTGGCGGCCCTCGCCGCTGTGGAAGCAGAGAAGGACATGCGGATTGTGGAAGA
:::::::.::::::::::::::::::::::: :::::::::::::::.::::.:::::::::::.::::::::::::::::::::::...::::::::::
TGTGTAACGTGGATCACCAGAACAAGGCAGGGTACACCCCCATCATGCTGGCAGCCCTCGCCGCCGTGGAAGCAGAGAAGGACATGCAAGTTGTGGAAGA
V--C--N--V--D--H--Q--N--K--A--G--Y--T--P--I--M--L--A--A--L--A--A--V--E--A--E--K--D--M--Q--V--V--E--E

---------------------------------------><-----------------------------------------------------------
--L--F--G--C--G--D--V--N--A--K--A--S--Q--A--G--Q--T--A--L--M--L--A--V--S--H--G--R--I--D--M--V--K--G-
ACTCTTCGGCTGTGGGGATGTGAATGCCAAAGCTAGTCAGGCGGGACAGACGGCCCTCATGCTGGCGGTCAGTCACGGACGGATAGACATGGTGAAGGGC
::::::.:::::::::::.::::::::::::::.::.:::::.::::::::.::::::::::::::.::::::::.::.::::::::.::::::::::::
ACTCTTTGGCTGTGGGGACGTGAATGCCAAAGCCAGCCAGGCAGGACAGACAGCCCTCATGCTGGCAGTCAGTCATGGGCGGATAGATATGGTGAAGGGC
--L--F--G--C--G--D--V--N--A--K--A--S--Q--A--G--Q--T--A--L--M--L--A--V--S--H--G--R--I--D--M--V--K--G-

----------------------------------------------------------------------------------------------------
-L--L--A--C--G--A--D--V--N--I--Q--D--D--E--G--S--T--A--L--M--C--A--S--E--H--G--H--V--E--I--V--K--L--
CTTCTGGCCTGTGGGGCTGATGTCAACATCCAGGATGACGAGGGCTCCACGGCCCTCATGTGTGCCAGCGAGCACGGACACGTGGAGATTGTCAAGCTGC
:: :::::::::::::::::.::::::::::::::.::::::::.::::: ::::: ::::::::.::.:::::.:: ::::::::::::::::::::::
CTGCTGGCCTGTGGGGCTGACGTCAACATCCAGGACGACGAGGGTTCCACCGCCCTGATGTGTGCTAGTGAGCATGGCCACGTGGAGATTGTCAAGCTGC
-L--L--A--C--G--A--D--V--N--I--Q--D--D--E--G--S--T--A--L--M--C--A--S--E--H--G--H--V--E--I--V--K--L--

----------------------------------------><----------------------------------------------------------
L--L--A--Q--P--G--C--N--G--H--L--E--D--N--D--G--S--T--A--L--S--I--A--L--E--A--G--H--K--D--I--A--V--L
TGCTGGCCCAGCCCGGCTGCAACGGTCACCTAGAGGACAACGATGGCAGCACTGCGCTCTCAATCGCCCTGGAAGCAGGACACAAGGACATCGCTGTTCT
::::::::::::: ::::::::.::.:::::.:::::::::                  ::::: ::::::::::::::::::::::::::.::.:::::
TGCTGGCCCAGCCGGGCTGCAATGGCCACCTGGAGGACAAC------------------TCAATAGCCCTGGAAGCAGGACACAAGGACATTGCCGTTCT
L--L--A--Q--P--G--C--N--G--H--L--E--D--N--------------------S--I--A--L--E--A--G--H--K--D--I--A--V--L

---------------------------------------><-----------------------------------------------------------
--L--Y--A--H--V--N--F--A--K--A--Q--S--P--G--T--P--R--L--G--R--K--T--S--P--G--P--T--H--R--G--S--F--D-
TCTGTATGCCCATGTCAACTTTGCAAAAGCCCAGTCTCCGGGCACCCCTAGGCTTGGAAGGAAGACGTCTCCTGGCCCCACCCACCGAGGTTCATTTGAT
 :::::.:::::.::::::::.::.::::::::::::::::::::::: :::::::::::::::::.::::::::.::::::::::::::::::::::::
GCTGTACGCCCACGTCAACTTCGCGAAAGCCCAGTCTCCGGGCACCCCAAGGCTTGGAAGGAAGACATCTCCTGGTCCCACCCACCGAGGTTCATTTGAT
--L--Y--A--H--V--N--F--A--K--A--Q--S--P--G--T--P--R--L--G--R--K--T--S--P--G--P--T--H--R--G--S--F--D-

-->
-*-
TGA
:::
TGA
-*-

Pig Consensus Sequence

>BGISUST0000884025
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------------------------------------AGAAGTGGTGGGGAGTTATACATTGACTATGAGGAGGAAGAGATGGAGAGTGTGGAG
CAGAGCACACAGCGGATAAAGGAGTTCCGGCAGCTCACAGCAGACATGCAAGCCCTGGAGCAGAAGATCCAGGATAGCAGCTATGAGGCTTCCTCAGAGG
TCAGGGAGAACGGGGAGTGTCGACCTCGAGAATGCCGGTCTGTGGCTGTGGGCGCCAACGAGAACATGGACGACATTGTCGTGTATCACAGGGGTGCCAG
GTCTTGTAAGGATGCCTCTGTAGGGACAGTCACTGAGACAAGGAATTCTGGGGTCAGCGTGACAGAGGCCATGCTTGGAGTGACCACTGAAGCTGACAAG
GAAATTGAGCTACAGCAGCAAACCATAGAAGCCTTAAAGGAAAAGATCTACCGCCTGGAAGTGCAGCTGAAAGAAACCACCCATGACCGGGAGATGACTA
AACTCAAGCAAGAGCTGCAAGCTGCTGGATCGAGGAAAAAAGTTGACAAAGCCGTGATGGCCCAGACACTTGTTTTCAGCAAGATGGTGGAGGCGGTGGT
ACTGATGAGAGACCAGATGGCTGGCAGTCACGTGGACGTGGTTGACACATGTGTGGGGACCTGCATACAGACA---------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
--------------------------AGTAATTTGGAATATACCTGTAAGTGTGGAAGCCTTCAGTCAAGAGGACCATTAAACCCCCAGACATCCCAGCA
TGAGCAAGAGGTGGGGACCACGGAAGGGAAGCCCATCAGCGGCCAGGATACCTTCCCCCCTCAGGAAACCACATTGTCTGCAGTGAACCTGACAGATGAC
CAGATAGCCGCTGGCCTCTAT---TGTACAAATAACGAAAGTACACTGAAGTCCATCATGAAGAAGAAAGATGCCAACAAAGATTCAAATGGAGCGAAGA
AGAATCTTCAGTTTGTTGGCATTAATGGA---TATGAAACAACTTCAAGTGATGCTTCCAGCTCAGAGGAAAGCTCTTCTTCCGAGTCAGATGACGAGTG
TGATGTCCCTGACTGTCCTCCTGAGGAAGAGGAGGAGGAAGAGGAGGACGGAGTCACTCGGGGAATGGCGGAAGGGCAGCGTGCAGTTAATGTGGAAGGT
TTCAAGTCCACCAGGGTGGAAGATGAAATGCAGGTTCCAGAATGTGAACCTGAGAAGGTGGAAATCAGA---TATGAATTAAGTGAAAAGATGTTGTCTG
CATGCAACTTACTGAAAAATAATATAAATGACCCCAGAGCTTTGACCAGCAAGGATATGAGGTTCTGTCTGAACACTCTCCAGCATGAGTGGTTCCGCGT
GTCCAGTCAGAAGTCAGCCATCCCGGCCATGGTGGGGGACTACATCACCGCCTTCGAGGCCATCTCCCCAGATGTTCTCCGCCACATCATCAACATGGCA
GATGGCAATGGCAACACCGCCCTCCACTACAGCGTGTCCCACTCCAACTTTGAGATCGTCAAGCTGCTCTTGGAT------GTGTGTAACGTGGATCACC
AGAACAAGGCAGGGTACACCCCCATCATGCTGGCAGCCCTCGCCGCCGTGGAAGCAGAGAAGGACATGCAAGTTGTGGAAGAACTCTTTGGCTGTGGGGA
CGTGAATGCCAAAGCCAGCCAGGCAGGACAGACAGCCCTCATGCTGGCAGTCAGTCATGGGCGGATAGATATGGTGAAGGGCCTGCTGGCCTGTGGGGCT
GACGTCAACATCCAGGACGACGAGGGTTCCACCGCCCTGATGTGTGCTAGTGAGCATGGCCACGTGGAGATTGTCAAGCTGCTGCTGGCCCAGCCGGGCT
GCAATGGCCACCTGGAGGACAAC------------------TCAATAGCCCTGGAAGCAGGACACAAGGACATTGCCGTTCTGCTGTACGCCCACGTCAA
CTTCGCGAAAGCCCAGTCTCCGGGCACCCCAAGGCTTGGAAGGAAGACATCTCCTGGTCCCACCCACCGAGGTTCATTTGATTGA


>BGISUSP0000884025
----------------------------------------------------------------------------------------------------
---------------------------------------------------------------------------------RSGGELYIDYEEEEMESVE
QSTQRIKEFRQLTADMQALEQKIQDSSYEASSEVRENGECRPRECRSVAVGANENMDDIVVYHRGARSCKDASVGTVTETRNSGVSVTEAMLGVTTEADK
EIELQQQTIEALKEKIYRLEVQLKETTHDREMTKLKQELQAAGSRKKVDKAVMAQTLVFSKMVEAVVLMRDQMAGSHVDVVDTCVGTCIQT---------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
------------------------------------------SNLEYTCKCGSLQSRGPLNPQTSQHEQEVGTTEGKPISGQDTFPPQETTLSAVNLTDD
QIAAGLY-CTNNESTLKSIMKKKDANKDSNGAKKNLQFVGING-YETTSSDASSSEESSSSESDDECDVPDCPPEEEEEEEEDGVTRGMAEGQRAVNVEG
FKSTRVEDEMQVPECEPEKVEIR-YELSEKMLSACNLLKNNINDPRALTSKDMRFCLNTLQHEWFRVSSQKSAIPAMVGDYITAFEAISPDVLRHIINMA
DGNGNTALHYSVSHSNFEIVKLLLD--VCNVDHQNKAGYTPIMLAALAAVEAEKDMQVVEELFGCGDVNAKASQAGQTALMLAVSHGRIDMVKGLLACGA
DVNIQDDEGSTALMCASEHGHVEIVKLLLAQPGCNGHLEDN------SIALEAGHKDIAVLLYAHVNFAKAQSPGTPRLGRKTSPGPTHRGSFD*