Sequences
EST Library Info
cje1Jejunum - RNA from China
lyg1Lymphatic gland
plac2Unavailable
ute1Uterus
Clusters
Oligos
SNPs

Gene ID ENSG00000095739 (click for geneview)
Transcript ID ENST00000224324(link to ensembl)
Symbol BAMBI
Localtion Chromosome:10:29006459:29011702:1 band: 10p12.1
Description BMP and activin membrane-bound inhibitor homolog precursor (Putative transmembrane protein NMA) (Non-metastatic gene A protein). [Source:Uniprot/SWISSPROT;Acc:Q13145]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<--------------------------------------------------------------------------><-----------------------
-M--D--R--H--S--S--Y--I--F--I--W--L--Q--L--E--L--C--A--M--A--V--L--L--T--K--G--E--I--R--C--Y--C--D--
ATGGATCGCCACTCCAGCTACATCTTCATCTGGCTGCAGCTGGAGCTCTGCGCCATGGCCGTGCTGCTCACCAAAGGTGAAATTCGATGCTACTGTGATG
:::::::::::::::::::::::::::.::::::::::::::::.::::::::::::::::::::::::::::::   :::::. :::::::::::::::
ATGGATCGCCACTCCAGCTACATCTTCGTCTGGCTGCAGCTGGAACTCTGCGCCATGGCCGTGCTGCTCACCAAA---GAAATCAGATGCTACTGTGATG
-M--D--R--H--S--S--Y--I--F--V--W--L--Q--L--E--L--C--A--M--A--V--L--L--T--K-----E--I--R--C--Y--C--D--

----------------------------------------------------------------------------------------------------
A--A--H--C--V--A--T--G--Y--M--C--K--S--E--L--S--A--C--F--S--R--L--L--D--P--Q--N--S--N--S--P--L--T--H
CTGCCCACTGTGTAGCCACTGGTTATATGTGTAAATCTGAGCTCAGCGCCTGCTTCTCTAGACTTCTTGATCCTCAGAACTCAAATTCCCCACTCACCCA
:.:::::::::::.::.::::::::::::::.::::::::::: ::::::::::::::.::.:::::.::::::::::::.:::::::::: ::::::::
CCGCCCACTGTGTGGCTACTGGTTATATGTGCAAATCTGAGCTGAGCGCCTGCTTCTCCAGGCTTCTCGATCCTCAGAACCCAAATTCCCCTCTCACCCA
A--A--H--C--V--A--T--G--Y--M--C--K--S--E--L--S--A--C--F--S--R--L--L--D--P--Q--N--P--N--S--P--L--T--H

----------------------------------------------------------------------------------------------------
--G--C--L--D--S--L--A--S--T--T--D--I--C--Q--A--K--Q--A--R--N--H--S--G--T--T--I--P--T--L--E--C--C--H-
TGGCTGCCTGGACTCTCTTGCAAGCACGACAGACATCTGCCAAGCCAAACAGGCCCGAAACCACTCTGGCACCACCATACCCACATTGGAATGCTGTCAT
.:::::.::::::::::::::::::::..::::::::::::::::::::::::: :::::::::::.::::::.::.: :::::..:::::::::::::.
CGGCTGTCTGGACTCTCTTGCAAGCACAGCAGACATCTGCCAAGCCAAACAGGCACGAAACCACTCCGGCACCGCCGTCCCCACGCTGGAATGCTGTCAC
--G--C--L--D--S--L--A--S--T--A--D--I--C--Q--A--K--Q--A--R--N--H--S--G--T--A--V--P--T--L--E--C--C--H-

---------------------------------------------------------------><-----------------------------------
-E--D--M--C--N--Y--R--G--L--H--D--V--L--S--P--P--R--G--E--A--S--G--Q--G--N--R--Y--Q--H--D--G--S--R--
GAAGACATGTGCAATTACAGAGGGCTGCACGATGTTCTCTCTCCTCCCAGGGGTGAGGCCTCAGGACAAGGAAACAGGTATCAGCATGATGGTAGCAGAA
:::::::::::::::::: :::::::::: :::::.::: :.:::::::.::: :::::::::   ::::: ::::::::::::: :::.::::::::::
GAAGACATGTGCAATTACCGAGGGCTGCAGGATGTCCTCGCCCCTCCCAAGGGGGAGGCCTCA---CAAGGCAACAGGTATCAGCCTGACGGTAGCAGAA
-E--D--M--C--N--Y--R--G--L--Q--D--V--L--A--P--P--K--G--E--A--S-----Q--G--N--R--Y--Q--P--D--G--S--R--

----------------------------------------------------------------------------------------------------
N--L--I--T--K--V--Q--E--L--T--S--S--K--E--L--W--F--R--A--A--V--I--A--V--P--I--A--G--G--L--I--L--V--L
ACCTTATCACCAAGGTGCAGGAGCTGACTTCTTCCAAAGAGTTGTGGTTCCGGGCAGCGGTCATTGCCGTGCCCATTGCTGGAGGGCTGATTTTAGTGTT
::::.::::::::.:::::::::::::::::.:::::::::::::::::::::::.::.:: ::.::.:: :::::.::.:::::::::::..:.:::::
ACCTCATCACCAAAGTGCAGGAGCTGACTTCCTCCAAAGAGTTGTGGTTCCGGGCGGCAGTGATCGCTGTTCCCATCGCCGGAGGGCTGATCCTGGTGTT
N--L--I--T--K--V--Q--E--L--T--S--S--K--E--L--W--F--R--A--A--V--I--A--V--P--I--A--G--G--L--I--L--V--L

----------------------------------------------------------------------------------------------------
--L--I--M--L--A--L--R--M--L--R--S--E--N--K--R--L--Q--D--Q--R--Q--Q--M--L--S--R--L--H--Y--S--F--H--G-
GCTTATTATGTTGGCCCTGAGGATGCTTCGAAGTGAAAATAAGAGGCTGCAGGATCAGCGGCAACAGATGCTCTCCCGTTTGCACTACAGCTTTCACGGA
::: ::.:::.:::::::::::::::: ::.::.::.::.::::::::::::::.::::::::.:::::::: ::::::::::::::::::::.::::::
GCTGATCATGCTGGCCCTGAGGATGCTGCGGAGCGAGAACAAGAGGCTGCAGGACCAGCGGCAGCAGATGCTGTCCCGTTTGCACTACAGCTTCCACGGA
--L--I--M--L--A--L--R--M--L--R--S--E--N--K--R--L--Q--D--Q--R--Q--Q--M--L--S--R--L--H--Y--S--F--H--G-

----------------------------------------------------------------------------------------------------
-H--H--S--K--K--G--Q--V--A--K--L--D--L--E--C--M--V--P--V--S--G--H--E--N--C--C--L--T--C--D--K--M--R--
CACCATTCCAAAAAGGGGCAGGTTGCAAAGTTAGACTTGGAATGCATGGTGCCGGTCAGTGGGCACGAGAACTGCTGTCTGACCTGTGATAAAATGAGAC
:.:::.:::::::::::::::::::: :::::.::::::::.::::::::::: :: ::::: :::::::::::::::::::: ::.:::::.:::::.:
CGCCACTCCAAAAAGGGGCAGGTTGCCAAGTTGGACTTGGAGTGCATGGTGCCTGTGAGTGGCCACGAGAACTGCTGTCTGACGTGCGATAAGATGAGGC
-R--H--S--K--K--G--Q--V--A--K--L--D--L--E--C--M--V--P--V--S--G--H--E--N--C--C--L--T--C--D--K--M--R--

---------------------------------------------------------------------------------->
Q--A--D--L--S--N--D--K--I--L--S--L--V--H--W--G--M--Y--S--G--H--G--K--L--E--F--V--*-
AAGCAGACCTCAGCAACGATAAGATCCTCTCGCTTGTTCACTGGGGCATGTACAGTGGGCACGGGAAGCTGGAATTCGTATGA
:::: ::::::::: ::::. .: :::::::::: :: :::::::::.:::::::.:: :.:::::.::::::.:::::::::
AAGCTGACCTCAGCCACGACCGGCTCCTCTCGCTGGTGCACTGGGGCGTGTACAGCGGCCGCGGGAGGCTGGAGTTCGTATGA
Q--A--D--L--S--H--D--R--L--L--S--L--V--H--W--G--V--Y--S--G--R--G--R--L--E--F--V--*-

Pig Consensus Sequence

>BGISUST0000880134
ATGGATCGCCACTCCAGCTACATCTTCGTCTGGCTGCAGCTGGAACTCTGCGCCATGGCCGTGCTGCTCACCAAA---GAAATCAGATGCTACTGTGATG
CCGCCCACTGTGTGGCTACTGGTTATATGTGCAAATCTGAGCTGAGCGCCTGCTTCTCCAGGCTTCTCGATCCTCAGAACCCAAATTCCCCTCTCACCCA
CGGCTGTCTGGACTCTCTTGCAAGCACAGCAGACATCTGCCAAGCCAAACAGGCACGAAACCACTCCGGCACCGCCGTCCCCACGCTGGAATGCTGTCAC
GAAGACATGTGCAATTACCGAGGGCTGCAGGATGTCCTCGCCCCTCCCAAGGGGGAGGCCTCA---CAAGGCAACAGGTATCAGCCTGACGGTAGCAGAA
ACCTCATCACCAAAGTGCAGGAGCTGACTTCCTCCAAAGAGTTGTGGTTCCGGGCGGCAGTGATCGCTGTTCCCATCGCCGGAGGGCTGATCCTGGTGTT
GCTGATCATGCTGGCCCTGAGGATGCTGCGGAGCGAGAACAAGAGGCTGCAGGACCAGCGGCAGCAGATGCTGTCCCGTTTGCACTACAGCTTCCACGGA
CGCCACTCCAAAAAGGGGCAGGTTGCCAAGTTGGACTTGGAGTGCATGGTGCCTGTGAGTGGCCACGAGAACTGCTGTCTGACGTGCGATAAGATGAGGC
AAGCTGACCTCAGCCACGACCGGCTCCTCTCGCTGGTGCACTGGGGCGTGTACAGCGGCCGCGGGAGGCTGGAGTTCGTATGA


>BGISUSP0000880134
MDRHSSYIFVWLQLELCAMAVLLTK-EIRCYCDAAHCVATGYMCKSELSACFSRLLDPQNPNSPLTHGCLDSLASTADICQAKQARNHSGTAVPTLECCH
EDMCNYRGLQDVLAPPKGEAS-QGNRYQPDGSRNLITKVQELTSSKELWFRAAVIAVPIAGGLILVLLIMLALRMLRSENKRLQDQRQQMLSRLHYSFHG
RHSKKGQVAKLDLECMVPVSGHENCCLTCDKMRQADLSHDRLLSLVHWGVYSGRGRLEFV*