Sequences
EST Library Info
fcc4Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000109047 (click for geneview)
Transcript ID ENST00000226193(link to ensembl)
Symbol RCV1
Localtion Chromosome:17:9741753:9749409:-1 band: 17p13.1
Description Recoverin (Cancer associated retinopathy protein) (CAR protein). [Source:Uniprot/SWISSPROT;Acc:P35243]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--G--N--S--K--S--G--A--L--S--K--E--I--L--E--E--L--Q--L--N--T--K--F--S--E--E--E--L--C--S--W--Y--Q--
ATGGGGAACAGCAAAAGTGGGGCCCTGTCCAAGGAGATCCTGGAGGAGCTGCAGCTGAACACCAAGTTCTCGGAGGAGGAGCTGTGCTCCTGGTACCAGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
S--F--L--K--D--C--P--T--G--R--I--T--Q--Q--Q--F--Q--S--I--Y--A--K--F--F--P--D--T--D--P--K--A--Y--A--Q
CCTTCCTGAAGGACTGTCCCACCGGCCGCATCACCCAGCAGCAGTTCCAGAGCATCTACGCCAAGTTCTTCCCCGACACCGACCCCAAGGCCTACGCCCA
                                                        ::.::::::::::::::::: .::::::::::::::::::::::
--------------------------------------------------------TATGCCAAGTTCTTCCCCGAGGCCGACCCCAAGGCCTACGCCCA
---------------------------------------------------------Y--A--K--F--F--P--E--A--D--P--K--A--Y--A--Q

----------------------------------------------------------------------------------------------------
--H--V--F-----R--S--F--D--S--N--L--D--G--T--L--D--F--K--E--Y--V--I--A--L--H--M--T--T--A--G--K--T--N-
GCATGTGTTC---CGCAGCTTCGATTCCAACCTCGACGGCACCCTGGACTTCAAGGAGTACGTCATCGCCCTGCACATGACCACCGCGGGCAAGACCAAC
::::::::::   .::::::::::: ::::.  :::::::::::::::::::::::::::::::::::::::::::::::::: :::::::::: :::.:
GCATGTGTTCC--TGCAGCTTCGATGCCAATAGCGACGGCACCCTGGACTTCAAGGAGTACGTCATCGCCCTGCACATGACCAGCGCGGGCAAGTCCAGC
--H--V--F--\--R--S--F--D--A--N--S--D--G--T--L--D--F--K--E--Y--V--I--A--L--H--M--T--S--A--G--K--S--S-

-----------------------------------------------------------------------------------><---------------
-Q--K--L--E--W--A--F--S--L--Y--D--V--D--G--N--G--T--I--S--K--N--E--V--L--E--I--V--M--A--I--F--K--M--
CAGAAGCTGGAGTGGGCCTTCTCCCTCTACGACGTGGACGGTAACGGGACCATCAGCAAGAATGAAGTGCTGGAGATCGTCATGGCTATTTTCAAAATGA
:::::::::::::::::.:::::::::::::::::::::::.::::::::::::::::::::.:::::::: ::::::.::   ::::::::::::::::
CAGAAGCTGGAGTGGGCTTTCTCCCTCTACGACGTGGACGGCAACGGGACCATCAGCAAGAACGAAGTGCTCGAGATCATC---GCTATTTTCAAAATGA
-Q--K--L--E--W--A--F--S--L--Y--D--V--D--G--N--G--T--I--S--K--N--E--V--L--E--I--I-----A--I--F--K--M--

-----------------------------------------------------------------------------------------------><---
I--T--P--E--D--V--K--L--L--P--D--D--E--N--T--P--E--K--R--A--E--K--I--W--K--Y--F--G--K--N--D--D--D--K
TCACTCCCGAGGACGTGAAGCTCCTTCCAGACGATGAAAACACGCCGGAAAAGCGAGCCGAGAAGATCTGGAAGTACTTTGGAAAGAATGATGATGATAA
::: :::.::::::.::::::  ::.:: :::::.:::::::: :::::.:::::::::::::::::::::..:: ::::::.::::: ::.:::   ::
TCAGTCCTGAGGACATGAAGCAGCTCCCCGACGACGAAAACACCCCGGAGAAGCGAGCCGAGAAGATCTGGGGGTTCTTTGGGAAGAAGGACGAT---AA
I--S--P--E--D--M--K--Q--L--P--D--D--E--N--T--P--E--K--R--A--E--K--I--W--G--F--F--G--K--K--D--D-----K

----------------------------------------------------------------------------------------------------
--L--T--E--K--E--F--I--E--G--T--L--A--N--K--E--I--L--R--L--I--Q--F--E--P--Q--K--V--K--E--K--M--K--N-
ACTTACAGAGAAAGAATTCATTGAGGGGACACTGGCCAATAAGGAAATTCTGCGACTGATCCAGTTTGAGCCTCAAAAAGTGAAGGAAAAGATGAAGAAC
:::::::::::::::.:::::.::::::::  :::::::::::::.:::::::::::::::::.:::::::::::::::::::::::.::: :::::   
ACTTACAGAGAAAGAGTTCATCGAGGGGACCATGGCCAATAAGGAGATTCTGCGACTGATCCAATTTGAGCCTCAAAAAGTGAAGGAGAAGCTGAAG---
--L--T--E--K--E--F--I--E--G--T--M--A--N--K--E--I--L--R--L--I--Q--F--E--P--Q--K--V--K--E--K--L--K----

----->
-A--*-
GCCTGA
      
------
------

Pig Consensus Sequence

>BGISUST0000890266
----------------------------------------------------------------------------------------------------
--------------------------------------------------------TATGCCAAGTTCTTCCCCGAGGCCGACCCCAAGGCCTACGCCCA
GCATGTGTTctGCAGCTTCGATGCCAATAGCGACGGCACCCTGGACTTCAAGGAGTACGTCATCGCCCTGCACATGACCAGCGCGGGCAAGTCCAGCCAG
AAGCTGGAGTGGGCTTTCTCCCTCTACGACGTGGACGGCAACGGGACCATCAGCAAGAACGAAGTGCTCGAGATCATC---GCTATTTTCAAAATGATCA
GTCCTGAGGACATGAAGCAGCTCCCCGACGACGAAAACACCCCGGAGAAGCGAGCCGAGAAGATCTGGGGGTTCTTTGGGAAGAAGGACGAT---AAACT
TACAGAGAAAGAGTTCATCGAGGGGACCATGGCCAATAAGGAGATTCTGCGACTGATCCAATTTGAGCCTCAAAAAGTGAAGGAGAAGCTGAAG------
---


>BGISUSP0000890266
----------------------------------------------------YAKFFPEADPKAYAQHVFCSFDANSDGTLDFKEYVIALHMTSAGKSSQ
KLEWAFSLYDVDGNGTISKNEVLEII-AIFKMISPEDMKQLPDDENTPEKRAEKIWGFFGKKDD-KLTEKEFIEGTMANKEILRLIQFEPQKVKEKLK--
-