Sequences
EST Library Info
eje1Foetus 50 days, jejunum
fat1Fatt
jca1Joint capsule
mcp2Mammae, collostrum producing
plac1Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000109610 (click for geneview)
Transcript ID ENST00000226877(link to ensembl)
Symbol SOD3
Localtion Chromosome:4:24472324:24478733:1 band: 4p15.2
Description Extracellular superoxide dismutase [Cu-Zn] precursor (EC 1.15.1.1) (EC-SOD). [Source:Uniprot/SWISSPROT;Acc:P08294]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--L--A--L--L--C--S--C--L--L--L--A--A--G--A--S--D--A--W--T--G--E--D--S--A--E--P--N--S--D--S--A--E--
ATGCTGGCGCTACTGTGTTCCTGCCTGCTCCTGGCAGCCGGTGCCTCGGACGCCTGGACGGGCGAGGACTCGGCGGAGCCCAACTCTGACTCGGCGGAGT
::::::.::::.:: ::: :.:.::::::::::::. ::::.::::: ::::::: :::  .:: :::: .:: : .::: ..:::. :: .:: ::::.
ATGCTGACGCTGCTCTGTGCTTACCTGCTCCTGGCGCCCGGCGCCTCCGACGCCTTGACCCACGTGGACGTGGAGCGGCCAGGCTCCCACATGGAGGAGC
-M--L--T--L--L--C--A--Y--L--L--L--A--P--G--A--S--D--A--L--T--H--V--D--V--E--R--P--G--S--H--M--E--E--

----------------------------------------------------------------------------------------------------
W--I--R--D--M--Y--A--K--V--T--E--I--W--Q--E--V--M--Q--R--R--D--D--D--G--------------A--L--H--A--A--C
GGATCCGAGACATGTACGCCAAGGTCACGGAGATCTGGCAGGAGGTCATGCAGCGGCGGGACGACGACGGC------------GCGCTCCACGCCGCCTG
.::::::.::::::.: :::::.:: :::::::::::::::::: : :.:::::.:::::  :  :.::::            ::::::::::::.::::
AGATCCGGGACATGCAGGCCAAAGTGACGGAGATCTGGCAGGAGTTGACGCAGCAGCGGGCGGCGGGCGGCGGCCAGGAGGCCGCGCTCCACGCCACCTG
Q--I--R--D--M--Q--A--K--V--T--E--I--W--Q--E--L--T--Q--Q--R--A--A--G--G--G--Q--E--A--A--L--H--A--T--C

----------------------------------------------------------------------------------------------------
--Q--V--Q--P--S--A--T--L--D--A--A--Q--P--R--V--T--G--V--V--L--F--R--Q--L--A--P--R--A--K--L--D--A--F-
CCAGGTGCAGCCGTCGGCCACGCTGGACGCCGCGCAGCCCCGGGTGACCGGCGTCGTCCTCTTCCGGCAGCTTGCGCCCCGCGCCAAGCTCGACGCCTTC
:. :.::::::: ::::.: .::::::::: ::::::::::.:::::::::: :.:: ::::::::::::::.  :::: :::::  :::::: ::::::
CTCGATGCAGCCTTCGGTCTTGCTGGACGCGGCGCAGCCCCAGGTGACCGGCCTTGTGCTCTTCCGGCAGCTCCGGCCCGGCGCCCTGCTCGAGGCCTTC
--S--M--Q--P--S--V--L--L--D--A--A--Q--P--Q--V--T--G--L--V--L--F--R--Q--L--R--P--G--A--L--L--E--A--F-

----------------------------------------------------------------------------------------------------
-F--A--L--E--G--F--P--T--E--P--N--S--S--S--R--A--I--H--V--H--Q--F--G--D--L--S--Q--G--C--E--S--T--G--
TTCGCCCTGGAGGGCTTCCCGACCGAGCCGAACAGCTCCAGCCGCGCCATCCACGTGCACCAGTTCGGGGACCTGAGCCAGGGCTGCGAGTCCACCGGGC
:::  ::::.:::::::::::.::::::: :::::: :::::::::::::::::::::::::::::::::::::::::::::::::::: ::::: ::::
TTCCACCTGAAGGGCTTCCCGGCCGAGCCCAACAGCACCAGCCGCGCCATCCACGTGCACCAGTTCGGGGACCTGAGCCAGGGCTGCGACTCCACAGGGC
-F--H--L--K--G--F--P--A--E--P--N--S--T--S--R--A--I--H--V--H--Q--F--G--D--L--S--Q--G--C--D--S--T--G--

----------------------------------------------------------------------------------------------------
P--H--Y--N--P--L--A--V--P--H--P--Q--H--P--G--D--F--G--N--F--A--V--R--D--G--S--L--W--R--Y--R--A--G--L
CCCACTACAACCCGCTGGCCGTGCCGCACCCGCAGCACCCGGGCGACTTCGGCAACTTCGCGGTCCGCGACGGCAGCCTCTGGAGGTACCGCGCCGGCCT
: ::::::::::::::::  :::::.::.:::::::::::::: ::::::::::::::::: :: ::::::::: .  :::::::::::::: ::.:::.
CGCACTACAACCCGCTGGAGGTGCCACATCCGCAGCACCCGGGAGACTTCGGCAACTTCGCCGTGCGCGACGGCCAGATCTGGAGGTACCGCTCCAGCCC
P--H--Y--N--P--L--E--V--P--H--P--Q--H--P--G--D--F--G--N--F--A--V--R--D--G--Q--I--W--R--Y--R--S--S--P

----------------------------------------------------------------------------------------------------
--A--A--S--L--A--G--P--H--S--I--V--G--R--A--V--V--V--H--A--G--E--D--D--L--G--R--G--G--N--Q--A--S--V-
GGCCGCCTCGCTCGCGGGCCCGCACTCCATCGTGGGCCGGGCCGTGGTCGTCCACGCTGGCGAGGACGACCTGGGCCGCGGCGGCAACCAGGCCAGCGTG
:: :::::::::: . ::::::::::: ::::.:::::: :: ::::: :::::::: ::::::::::::::::::::::::::::::::::::::: ::
GGGCGCCTCGCTCTTCGGCCCGCACTCGATCGCGGGCCGCGCGGTGGTGGTCCACGCGGGCGAGGACGACCTGGGCCGCGGCGGCAACCAGGCCAGCCTG
--G--A--S--L--F--G--P--H--S--I--A--G--R--A--V--V--V--H--A--G--E--D--D--L--G--R--G--G--N--Q--A--S--L-

----------------------------------------------------------------------------------------------------
-E--N--G--N--A--G--R--R--L--A--C--C--V--V--G--V--C--G--P--G--L--W--E--R--Q--A--R--E--H--S--E--R--K--
GAGAACGGGAACGCGGGCCGGCGGCTGGCCTGCTGCGTGGTGGGCGTGTGCGGGCCCGGGCTCTGGGAGCGCCAGGCGCGGGAGCACTCAGAGCGCAAGA
:::::::: ::::: ::::: :: ::::::::::::::::::: : ::::::: :::::::.::::: ::.::::::::.::::::: : ::::.::.::
GAGAACGGCAACGCCGGCCGCCGCCTGGCCTGCTGCGTGGTGGCCCTGTGCGGCCCCGGGCCCTGGGCGCACCAGGCGCAGGAGCACGCCGAGCACAGGA
-E--N--G--N--A--G--R--R--L--A--C--C--V--V--A--L--C--G--P--G--P--W--A--H--Q--A--Q--E--H--A--E--H--R--

---------------------------------->
K--R--R--R--E--S--E--C--K--A--A--*-
AGCGGCGGCGCGAGAGCGAGTGCAAGGCCGCCTGA
:::::::::::: .:::::::::::::::. :   
AGCGGCGGCGCGCAAGCGAGTGCAAGGCCAGC---
K--R--R--R--A--S--E--C--K--A--S----

Pig Consensus Sequence

>BGISUST0000895032
ATGCTGACGCTGCTCTGTGCTTACCTGCTCCTGGCGCCCGGCGCCTCCGACGCCTTGACCCACGTGGACGTGGAGCGGCCAGGCTCCCACATGGAGGAGC
AGATCCGGGACATGCAGGCCAAAGTGACGGAGATCTGGCAGGAGTTGACGCAGCAGCGGGCGGCGGGCGGCGGCCAGGAGGCCGCGCTCCACGCCACCTG
CTCGATGCAGCCTTCGGTCTTGCTGGACGCGGCGCAGCCCCAGGTGACCGGCCTTGTGCTCTTCCGGCAGCTCCGGCCCGGCGCCCTGCTCGAGGCCTTC
TTCCACCTGAAGGGCTTCCCGGCCGAGCCCAACAGCACCAGCCGCGCCATCCACGTGCACCAGTTCGGGGACCTGAGCCAGGGCTGCGACTCCACAGGGC
CGCACTACAACCCGCTGGAGGTGCCACATCCGCAGCACCCGGGAGACTTCGGCAACTTCGCCGTGCGCGACGGCCAGATCTGGAGGTACCGCTCCAGCCC
GGGCGCCTCGCTCTTCGGCCCGCACTCGATCGCGGGCCGCGCGGTGGTGGTCCACGCGGGCGAGGACGACCTGGGCCGCGGCGGCAACCAGGCCAGCCTG
GAGAACGGCAACGCCGGCCGCCGCCTGGCCTGCTGCGTGGTGGCCCTGTGCGGCCCCGGGCCCTGGGCGCACCAGGCGCAGGAGCACGCCGAGCACAGGA
AGCGGCGGCGCGCAAGCGAG


>BGISUSP0000895032
MLTLLCAYLLLAPGASDALTHVDVERPGSHMEEQIRDMQAKVTEIWQELTQQRAAGGGQEAALHATCSMQPSVLLDAAQPQVTGLVLFRQLRPGALLEAF
FHLKGFPAEPNSTSRAIHVHQFGDLSQGCDSTGPHYNPLEVPHPQHPGDFGNFAVRDGQIWRYRSSPGASLFGPHSIAGRAVVVHAGEDDLGRGGNQASL
ENGNAGRRLACCVVALCGPGPWAHQAQEHAEHRKRRRASE