Sequences
EST Library Info
eep3Foetus 50 days, epidermis
Clusters
Oligos
SNPs

Gene ID ENSG00000089159 (click for geneview)
Transcript ID ENST00000228307(link to ensembl)
Symbol PXN
Localtion Chromosome:12:119110971:119127367:-1 band: 12q24.23
Description Paxillin. [Source:Uniprot/SWISSPROT;Acc:P49023]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-----><--------------------------------------------------------------------------------------------
-M--A--D--A--L--L--A--D--L--E--S--T--T--S--H--I--S--K--R--P--V--F--L--S--E--E--T--P--Y--S--Y--P--T--
ATGGCAGACGCCCTGCTGGCGGACTTGGAGTCTACCACCTCCCACATCTCCAAACGGCCTGTGTTCTTGTCGGAGGAGACCCCCTACTCATACCCAACTG
         ::.::::::::.:::::::::::.:::::::::::.::::::::::::::::::::::::::.::::::::::: :::::.::::::::::
---------GCTCTGCTGGCAGACTTGGAGTCCACCACCTCCCATATCTCCAAACGGCCTGTGTTCTTGTCAGAGGAGACCCCATACTCGTACCCAACTG
----------A--L--L--A--D--L--E--S--T--T--S--H--I--S--K--R--P--V--F--L--S--E--E--T--P--Y--S--Y--P--T--

----------------------------------------------------------------------------------------------------
G--N--H--T--Y--Q--E--I--A--V--P--P--P--V--P--P--P--P--S--S--E--A--L--N--G--T--I--L--D--P--L--D--Q--W
GAAACCACACATACCAGGAGATTGCCGTGCCACCCCCCGTCCCCCCACCCCCGTCCAGCGAGGCCCTCAATGGCACAATCCTTGACCCCTTAGACCAGTG
:::::::::::::::::::::::::::::::::::::.::::::::::::::.:::::.::::::::::::::: ::.:.::::::::  ::::::::::
GAAACCACACATACCAGGAGATTGCCGTGCCACCCCCTGTCCCCCCACCCCCATCCAGTGAGGCCCTCAATGGCTCAGTTCTTGACCCGATAGACCAGTG
G--N--H--T--Y--Q--E--I--A--V--P--P--P--V--P--P--P--P--S--S--E--A--L--N--G--S--V--L--D--P--I--D--Q--W

---------------------------------><-----------------------------------------------------------------
--Q--P--S--S--S--R--F--I--H--Q--Q--P--Q--S--S--S--P--V--Y--G--S--S--A--K--T--S--S--V--S--N--P--Q--D-
GCAGCCCAGCAGCTCCCGATTCATCCACCAGCAGCCTCAGTCCTCATCACCTGTGTACGGCTCCAGTGCCAAAACTTCCAGTGTCTCCAACCCTCAGGAC
:::.::::::: :::::::::::::::::::::::::::: ::.:::: ::::::::::::::::::::::::::::::::: .:::::::::.::::::
GCAACCCAGCACCTCCCGATTCATCCACCAGCAGCCTCAGGCCCCATCCCCTGTGTACGGCTCCAGTGCCAAAACTTCCAGTTCCTCCAACCCCCAGGAC
--Q--P--S--T--S--R--F--I--H--Q--Q--P--Q--A--P--S--P--V--Y--G--S--S--A--K--T--S--S--S--S--N--P--Q--D-

-------------------------------------------------><-------------------------------------------------
-S--V--G--S--P--C--S--R--V--G--E--E--E--H--V--Y--S--F--P--N--K--Q--K--S--A--E--P--S--P--T--V--M--S--
AGTGTTGGCTCTCCGTGCTCCCGAGTGGGTGAGGAGGAGCACGTCTACAGCTTCCCCAACAAGCAGAAATCAGCTGAGCCTTCACCCACCGTAATGAGCA
.:..:.:::..::::::..: ::::. .:.:::::::::::::: :::   ::.::::::::::::::.::.:::::::::::::::::::: :::::: 
GGCATCGGCCTTCCGTGTCCACGAGCCAGCGAGGAGGAGCACGTGTAC---TTTCCCAACAAGCAGAAGTCGGCTGAGCCTTCACCCACCGTCATGAGCT
-G--I--G--L--P--C--P--R--A--S--E--E--E--H--V--Y-----F--P--N--K--Q--K--S--A--E--P--S--P--T--V--M--S--

--------------------------------------------------------------------------------------><------------
T--S--L--G--S--N--L--S--E--L--D--R--L--L--L--E--L--N--A--V--Q--H--N--P--P--G--F--P--A--D--E--A--N--S
CGTCCCTGGGCAGCAACCTTTCTGAACTCGACCGCCTGCTGCTGGAACTGAACGCTGTACAGCATAACCCGCCAGGCTTCCCTGCAGATGAGGCCAACTC
: :::.::::::::::::::::::::::.:::::.:::::::::::.:::::.:::::.::::::::: : :::::::::::.      :.:::::::::
CCTCCTTGGGCAGCAACCTTTCTGAACTTGACCGTCTGCTGCTGGAGCTGAATGCTGTGCAGCATAACGCCCCAGGCTTCCCC------GGGGCCAACTC
S--S--L--G--S--N--L--S--E--L--D--R--L--L--L--E--L--N--A--V--Q--H--N--A--P--G--F--P--------G--A--N--S

----------------------------------------------------------------------------------------------------
--S--P--P--L--P--G--A--L--S--P--L--Y--G--V--P--E--T--N--S--P--L--G--G--K--A--G--P--L--T--K--E--K--P-
AAGCCCCCCGCTTCCTGGGGCCCTGAGCCCCCTCTATGGTGTCCCAGAGACTAACAGCCCCTTGGGAGGCAAAGCTGGGCCCCTGACGAAAGAGAAGCCT
:::::::::.:: ::::::::.:::::::: : ::::::.::::..::.  .::::::.: .::::.:::::::. :::::  :::: :::::::::::.
AAGCCCCCCACTGCCTGGGGCTCTGAGCCCACACTATGGCGTCCTGGAACACAACAGCTCACTGGGGGGCAAAGTGGGGCCGGTGACCAAAGAGAAGCCC
--S--P--P--L--P--G--A--L--S--P--H--Y--G--V--L--E--H--N--S--S--L--G--G--K--V--G--P--V--T--K--E--K--P-

----------------------------------------------------------------------------------------><----------
-K--R--N--G--G--R--G--L--E--D--V--R--P--S--V--E--S--L--L--D--E--L--E--S--S--V--P--S--P--V--P--A--I--
AAGCGGAATGGGGGCCGGGGCCTGGAGGACGTGCGGCCCAGTGTGGAGAGTCTCTTGGATGAACTGGAGAGCTCCGTGCCCAGCCCCGTCCCTGCCATCA
:::::::::::.::::: :::::: ::::.::::: :::::.::::::::::::                                    ::::::::::
AAGCGGAATGGAGGCCGCGGCCTGNAGGATGTGCGCCCCAGCGTGGAGAGTCTC------------------------------------CCTGCCATCA
-K--R--N--G--G--R--G--L--X--D--V--R--P--S--V--E--S--L--------------------------------------P--A--I--

----------------------------------------------------------------------------------------------------
T--V--N--Q--G--E--M--S--S--P--Q--R--V--T--S--T--Q--Q--Q--T--R--I--S--A--S--S--A--T--R--E--L--D--E--L
CTGTGAACCAGGGCGAGATGAGCAGCCCGCAGCGCGTCACCTCCACCCAACAGCAGACACGCATCTCGGCCTCCTCTGCCACCAGGGAGCTGGACGAGCT
:::::::::::::.:::::::.:::::: ::::: :::::::::: :::.::::::::.::::::::.::::::::::::::::::::::::::::::::
CTGTGAACCAGGGTGAGATGAACAGCCCCCAGCGAGTCACCTCCAGCCAGCAGCAGACGCGCATCTCAGCCTCCTCTGCCACCAGGGAGCTGGACGAGCT
T--V--N--Q--G--E--M--N--S--P--Q--R--V--T--S--S--Q--Q--Q--T--R--I--S--A--S--S--A--T--R--E--L--D--E--L

------------------------><--------------------------------------------------------------------------
--M--A--S--L--S--D--F--K--I--Q--G--L--E--Q--R--A--D--G--E--R--C--W--A--A--G--W--P--R--D--G--G--R--S-
GATGGCTTCGCTGTCGGATTTCAAGATCCAGGGCCTGGAGCAAAGAGCGGATGGGGAGCGGTGCTGGGCGGCCGGCTGGCCTCGGGACGGCGGGCGGAGC
::::::.::::::::.:::::.:::                                                                           
GATGGCCTCGCTGTCAGATTTTAAG---------------------------------------------------------------------------
--M--A--S--L--S--D--F--K----------------------------------------------------------------------------

--------------------------><------------------------------------------------------------------------
-S--P--G--G--Q--D--E--G--G--F--M--A--Q--G--K--T--G--S--S--S--P--P--G--G--P--P--K--P--G--S--Q--L--D--
AGCCCCGGAGGGCAGGACGAGGGAGGGTTCATGGCCCAGGGGAAGACAGGGAGCAGCTCACCCCCTGGGGGGCCCCCGAAGCCCGGGAGCCAGCTGGACA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------------------------------------------------------------><-
S--M--L--G--S--L--Q--S--D--L--N--K--L--G--V--A--T--V--A--K--G--V--C--G--A--C--K--K--P--I--A--G--Q--V
GCATGCTGGGGAGCCTGCAGTCTGACCTGAACAAGCTGGGGGTCGCCACAGTCGCCAAAGGAGTCTGCGGGGCCTGCAAGAAGCCCATCGCCGGGCAGGT
                                                                                                  ::
--------------------------------------------------------------------------------------------------GT
---------------------------------------------------------------------------------------------------V

----------------------------------------------------------------------------------------------------
--V--T--A--M--G--K--T--W--H--P--E--H--F--V--C--T--H--C--Q--E--E--I--G--S--R--N--F--F--E--R--D--G--Q-
TGTGACCGCCATGGGGAAGACGTGGCACCCCGAGCACTTCGTCTGCACCCACTGCCAGGAGGAGATCGGATCCCGGAACTTCTTCGAGCGGGATGGACAG
::::::.::::::::::::::::::::::: :::::.::::::::::::::::::::::::::::::::.::::::::::::::.:::::::::::::::
TGTGACTGCCATGGGGAAGACGTGGCACCCAGAGCATTTCGTCTGCACCCACTGCCAGGAGGAGATCGGGTCCCGGAACTTCTTTGAGCGGGATGGACAG
--V--T--A--M--G--K--T--W--H--P--E--H--F--V--C--T--H--C--Q--E--E--I--G--S--R--N--F--F--E--R--D--G--Q-

-----------------------------------------------------------------------><---------------------------
-P--Y--C--E--K--D--Y--H--N--L--F--S--P--R--C--Y--Y--C--N--G--P--I--L--D--K--V--V--T--A--L--D--R--T--
CCCTACTGTGAAAAGGACTACCACAACCTCTTCTCCCCGCGCTGCTACTACTGCAACGGCCCCATCCTGGATAAAGTGGTGACAGCCCTTGACCGGACGT
::::::::::::::::::::.::::::::::::::.::.:::                                                ::::::::::
CCCTACTGTGAAAAGGACTATCACAACCTCTTCTCTCCACGC------------------------------------------------GACCGGACGT
-P--Y--C--E--K--D--Y--H--N--L--F--S--P--R--------------------------------------------------D--R--T--

-----------------------------------------------------><---------------------------------------------
W--H--P--E--H--F--F--C--A--Q--C--G--A--F--F--G--P--E--G--F--H--E--K--D--G--K--A--Y--C--R--K--D--Y--F
GGCACCCTGAACACTTCTTCTGTGCACAGTGTGGAGCCTTCTTTGGTCCCGAAGGGTTCCACGAGAAGGACGGCAAGGCCTACTGTCGCAAGGACTACTT
::::::: ::.:::::::::::::: :::::::: ::::::::::: ::.:::   :::::::::::.:::::::::::::::::.:: :::::.:::::
GGCACCCGGAGCACTTCTTCTGTGCCCAGTGTGGCGCCTTCTTTGGGCCTGAA---TTCCACGAGAAAGACGGCAAGGCCTACTGCCGGAAGGATTACTT
W--H--P--E--H--F--F--C--A--Q--C--G--A--F--F--G--P--E-----F--H--E--K--D--G--K--A--Y--C--R--K--D--Y--F

----------------------------------------------------------------------------------------------------
--D--M--F--A--P--K--C--G--G--C--A--R--A--I--L--E--N--Y--I--S--A--L--N--T--L--W--H--P--E--C--F--V--C-
CGACATGTTCGCACCCAAGTGTGGCGGCTGCGCCCGGGCCATCCTGGAGAACTATATCTCAGCCCTCAACACGCTGTGGCATCCTGAGTGCTTTGTGTGC
.:::::::::::.:::::.:::::::::::.:::::::::::::::::::::::.:::::.::::::::::: :: ::::::::.::::::::.:::::.
TGACATGTTCGCGCCCAAATGTGGCGGCTGTGCCCGGGCCATCCTGGAGAACTACATCTCGGCCCTCAACACCCTCTGGCATCCCGAGTGCTTCGTGTGT
--D--M--F--A--P--K--C--G--G--C--A--R--A--I--L--E--N--Y--I--S--A--L--N--T--L--W--H--P--E--C--F--V--C-

--><------------------------------------------------------------------------------------------------
-R--E--C--F--T--P--F--V--N--G--S--F--F--E--H--D--G--Q--P--Y--C--E--V--H--Y--H--E--R--R--G--S--L--C--
CGGGAATGCTTCACGCCATTCGTGAACGGCAGCTTCTTCGAGCACGACGGGCAGCCCTACTGTGAGGTGCACTACCACGAGCGGCGCGGCTCGCTGTGTT
::::::::::::::::::::::: :::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::: :::::.:::::.:
CGGGAATGCTTCACGCCATTCGTCAACGGCAGCTTCTTCGAGCACGATGGGCAGCCCTACTGTGAGGTGCACTACCACGAGCGGCGGGGCTCACTGTGCT
-R--E--C--F--T--P--F--V--N--G--S--F--F--E--H--D--G--Q--P--Y--C--E--V--H--Y--H--E--R--R--G--S--L--C--

----------------------------------------------------------------------------------------------------
S--G--C--Q--K--P--I--T--G--R--C--I--T--A--M--A--K--K--F--H--P--E--H--F--V--C--A--F--C--L--K--Q--L--N
CTGGCTGCCAGAAGCCCATCACCGGCCGCTGCATCACCGCCATGGCCAAGAAGTTCCACCCCGAGCACTTCGTCTGTGCCTTCTGCCTCAAGCAGCTCAA
:::::::::::::::: ::::: :::::::::::::: :::::::::::.::::::::::: ::::::::::::::::::::::::::::::::::::::
CTGGCTGCCAGAAGCCGATCACGGGCCGCTGCATCACGGCCATGGCCAAAAAGTTCCACCCGGAGCACTTCGTCTGTGCCTTCTGCCTCAAGCAGCTCAA
S--G--C--Q--K--P--I--T--G--R--C--I--T--A--M--A--K--K--F--H--P--E--H--F--V--C--A--F--C--L--K--Q--L--N

--------------------------------------------------------------------->
--K--G--T--F--K--E--Q--N--D--K--P--Y--C--Q--N--C--F--L--K--L--F--C--*-
CAAGGGCACCTTCAAGGAGCAGAACGACAAGCCTTACTGTCAGAACTGCTTCCTCAAGCTCTTCTGCTAG
::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::.::::::
CAAGGGCACCTTCAAGGAGCAGAATGACAAGCCTTACTGTCAGAACTGCTTCCTCAAGCTCTTTTGCTAG
--K--G--T--F--K--E--Q--N--D--K--P--Y--C--Q--N--C--F--L--K--L--F--C--*-

Pig Consensus Sequence

>BGISUST0000898618
---------GCTCTGCTGGCAGACTTGGAGTCCACCACCTCCCATATCTCCAAACGGCCTGTGTTCTTGTCAGAGGAGACCCCATACTCGTACCCAACTG
GAAACCACACATACCAGGAGATTGCCGTGCCACCCCCTGTCCCCCCACCCCCATCCAGTGAGGCCCTCAATGGCTCAGTTCTTGACCCGATAGACCAGTG
GCAACCCAGCACCTCCCGATTCATCCACCAGCAGCCTCAGGCCCCATCCCCTGTGTACGGCTCCAGTGCCAAAACTTCCAGTTCCTCCAACCCCCAGGAC
GGCATCGGCCTTCCGTGTCCACGAGCCAGCGAGGAGGAGCACGTGTAC---TTTCCCAACAAGCAGAAGTCGGCTGAGCCTTCACCCACCGTCATGAGCT
CCTCCTTGGGCAGCAACCTTTCTGAACTTGACCGTCTGCTGCTGGAGCTGAATGCTGTGCAGCATAACGCCCCAGGCTTCCCC------GGGGCCAACTC
AAGCCCCCCACTGCCTGGGGCTCTGAGCCCACACTATGGCGTCCTGGAACACAACAGCTCACTGGGGGGCAAAGTGGGGCCGGTGACCAAAGAGAAGCCC
AAGCGGAATGGAGGCCGCGGCCTGNAGGATGTGCGCCCCAGCGTGGAGAGTCTC------------------------------------CCTGCCATCA
CTGTGAACCAGGGTGAGATGAACAGCCCCCAGCGAGTCACCTCCAGCCAGCAGCAGACGCGCATCTCAGCCTCCTCTGCCACCAGGGAGCTGGACGAGCT
GATGGCCTCGCTGTCAGATTTTAAG---------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
--------------------------------------------------------------------------------------------------GT
TGTGACTGCCATGGGGAAGACGTGGCACCCAGAGCATTTCGTCTGCACCCACTGCCAGGAGGAGATCGGGTCCCGGAACTTCTTTGAGCGGGATGGACAG
CCCTACTGTGAAAAGGACTATCACAACCTCTTCTCTCCACGC------------------------------------------------GACCGGACGT
GGCACCCGGAGCACTTCTTCTGTGCCCAGTGTGGCGCCTTCTTTGGGCCTGAA---TTCCACGAGAAAGACGGCAAGGCCTACTGCCGGAAGGATTACTT
TGACATGTTCGCGCCCAAATGTGGCGGCTGTGCCCGGGCCATCCTGGAGAACTACATCTCGGCCCTCAACACCCTCTGGCATCCCGAGTGCTTCGTGTGT
CGGGAATGCTTCACGCCATTCGTCAACGGCAGCTTCTTCGAGCACGATGGGCAGCCCTACTGTGAGGTGCACTACCACGAGCGGCGGGGCTCACTGTGCT
CTGGCTGCCAGAAGCCGATCACGGGCCGCTGCATCACGGCCATGGCCAAAAAGTTCCACCCGGAGCACTTCGTCTGTGCCTTCTGCCTCAAGCAGCTCAA
CAAGGGCACCTTCAAGGAGCAGAATGACAAGCCTTACTGTCAGAACTGCTTCCTCAAGCTCTTTTGCTAG


>BGISUSP0000898618
---ALLADLESTTSHISKRPVFLSEETPYSYPTGNHTYQEIAVPPPVPPPPSSEALNGSVLDPIDQWQPSTSRFIHQQPQAPSPVYGSSAKTSSSSNPQD
GIGLPCPRASEEEHVY-FPNKQKSAEPSPTVMSSSLGSNLSELDRLLLELNAVQHNAPGFP--GANSSPPLPGALSPHYGVLEHNSSLGGKVGPVTKEKP
KRNGGRGL-DVRPSVESL------------PAITVNQGEMNSPQRVTSSQQQTRISASSATRELDELMASLSDFK-------------------------
------------------------------------------------------------------VVTAMGKTWHPEHFVCTHCQEEIGSRNFFERDGQ
PYCEKDYHNLFSPR----------------DRTWHPEHFFCAQCGAFFGPE-FHEKDGKAYCRKDYFDMFAPKCGGCARAILENYISALNTLWHPECFVC
RECFTPFVNGSFFEHDGQPYCEVHYHERRGSLCSGCQKPITGRCITAMAKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCQNCFLKLFC*