Sequences
EST Library Info
ebs1Foetus 50 days, brain stem
lnt1Lymphatic nodule tracheobroncalis
mcp1Mammae, collostrum producing
sag2Salivary gland
ski1Skin
Clusters
Oligos
SNPs

Gene ID ENSG00000111445 (click for geneview)
Transcript ID ENST00000229043(link to ensembl)
Symbol RFC5
Localtion Chromosome:12:116917230:116932758:1 band: 12q24.23
Description Activator 1 36 kDa subunit (Replication factor C 36 kDa subunit) (A1 36 kDa subunit) (RF-C 36 kDa subunit) (RFC36) (Replication factor C subunit 5). [Source:Uniprot/SWISSPROT;Acc:P40937]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------><----------------------------------
-M--E--T--S--A--L--K--Q--Q--E--Q--P--A--A--T--K--I--R--N--L--P--W--V--E--K--Y--R--P--Q--T--L--N--D--
ATGGAGACCTCAGCACTCAAGCAGCAGGAGCAGCCCGCGGCGACCAAGATCAGGAACCTGCCCTGGGTTGAAAAATACCGGCCACAGACCCTGAATGATC
::: ::::::::::.: :::::::::: ::::::::: :::.:::::::::::::::::::::   ::::::::::::::::::::::: :::.::::::
ATGCAGACCTCAGCGCACAAGCAGCAGCAGCAGCCCGAGGCAACCAAGATCAGGAACCTGCCC---GTTGAAAAATACCGGCCACAGACACTGGATGATC
-M--Q--T--S--A--H--K--Q--Q--Q--Q--P--E--A--T--K--I--R--N--L--P-----V--E--K--Y--R--P--Q--T--L--D--D--

-----------------------------><---------------------------------------------------------------------
L--I--S--H--Q--D--I--L--S--T--I--Q--K--F--I--N--E--D--R--L--P--H--L--L--L--Y--G--P--P--G--T--G--K--T
TCATTTCTCATCAGGACATTCTGAGTACCATTCAGAAGTTTATCAATGAAGACCGACTGCCACACTTGCTTCTCTACGGTCCCCCAGGGACAGGCAAGAC
::::::::::::::::::::::::::      :::::::::::::.:::.::::: :: ::.:::.: ::::::::.:::::.::::: ::.:: :::::
TCATTTCTCATCAGGACATTCTGAGT------CAGAAGTTTATCAGTGAGGACCGCCTTCCGCACCTCCTTCTCTATGGTCCTCCAGGCACGGGAAAGAC
L--I--S--H--Q--D--I--L--S--------Q--K--F--I--S--E--D--R--L--P--H--L--L--L--Y--G--P--P--G--T--G--K--T

------------------------------------------------------------------><--------------------------------
--S--T--I--L--A--C--A--K--Q--L--Y--K--D--K--E--F--G--S--M--V--L--E--L--N--A--S--D--D--R--G--I--D--I-
ATCTACCATCCTAGCCTGTGCGAAACAGCTATATAAAGACAAAGAATTTGGCTCCATGGTCTTGGAGCTGAATGCTTCAGATGACCGAGGAATAGACATC
:::.::::::::.:::::::: ::::::::.::.:::::.::.:::::.:::::::::::::::::::::::::::::::::::::::::::::::.:::
ATCCACCATCCTGGCCTGTGCTAAACAGCTGTACAAAGATAAGGAATTCGGCTCCATGGTCTTGGAGCTGAATGCTTCAGATGACCGAGGAATAGATATC
--S--T--I--L--A--C--A--K--Q--L--Y--K--D--K--E--F--G--S--M--V--L--E--L--N--A--S--D--D--R--G--I--D--I-

----------------------------------------------><----------------------------------------------------
-I--R--G--P--I--L--S--F--A--S--T--R--T--I--F--K--K--G--F--K--L--V--I--L--D--E--A--D--A--M--T--Q--D--
ATTCGAGGACCGATCCTGAGCTTTGCTAGCACAAGGACAATATTTAAGAAAGGCTTTAAGCTAGTGATCTTGGATGAAGCAGACGCCATGACTCAGGACG
.::::.:::::.:::::::::::::::::::::::::::::::::   ::.::::::::.:::::::::::::::::::: ::.::::::::::::::.:
GTTCGGGGACCAATCCTGAGCTTTGCTAGCACAAGGACAATATTT---AAGGGCTTTAAACTAGTGATCTTGGATGAAGCTGATGCCATGACTCAGGATG
-V--R--G--P--I--L--S--F--A--S--T--R--T--I--F-----K--G--F--K--L--V--I--L--D--E--A--D--A--M--T--Q--D--

--------------------><------------------------------------------------------------------------------
A--Q--N--A--L--R--R--V--I--E--K--F--T--E--N--T--R--F--C--L--I--C--N--Y--L--S--K--I--I--P--A--L--Q--S
CCCAGAATGCCTTGAGAAGAGTAATTGAGAAATTCACAGAAAATACCAGATTCTGCCTCATCTGTAACTATCTGTCAAAGATCATCCCTGCCTTGCAGTC
:::::::.:::::: :.:::   :::::.:::::.:: ::::::::::::::.:::::::::::.::::::::::::::::::::.::.:::::::::::
CCCAGAACGCCTTGCGGAGA---ATTGAAAAATTTACTGAAAATACCAGATTTTGCCTCATCTGCAACTATCTGTCAAAGATCATTCCCGCCTTGCAGTC
A--Q--N--A--L--R--R-----I--E--K--F--T--E--N--T--R--F--C--L--I--C--N--Y--L--S--K--I--I--P--A--L--Q--S

--------------------------------------------------------------------------------><------------------
--R--C--T--R--F--R--F--G--P--L--T--P--E--L--M--V--P--R--L--E--H--V--V--E--E--E--K--V--D--I--S--E--D-
CCGCTGCACGAGGTTTCGGTTCGGTCCCCTGACTCCTGAACTCATGGTTCCCCGCCTGGAACATGTCGTGGAAGAAGAGAAAGTTGATATAAGTGAAGAT
::: ::.::.:::::.::.:::::.:::::::::::::::::::::::::::::::::::::::::.::.:::::::::   :::::::::::.::::::
CCGGTGTACAAGGTTCCGATTCGGCCCCCTGACTCCTGAACTCATGGTTCCCCGCCTGGAACATGTTGTAGAAGAAGAG---GTTGATATAAGCGAAGAT
--R--C--T--R--F--R--F--G--P--L--T--P--E--L--M--V--P--R--L--E--H--V--V--E--E--E-----V--D--I--S--E--D-

--------------------------------------------------------------><------------------------------------
-G--M--K--A--L--V--T--L--S--S--G--D--M--R--R--A--L--N--I--L--Q--S--T--N--M--A--F--G--K--V--T--E-----
GGAATGAAAGCACTAGTCACTCTTTCCAGTGGAGACATGCGTAGGGCTCTGAACATTTTGCAGAGCACCAATATGGCCTTTGGGAAGGTGACAGAG---G
::.::::::::.:: .: :: ::::::::::::::.::::: :::::.:::::.:::::::::               ::::::::::::::::::   :
GGGATGAAAGCGCTCATAACACTTTCCAGTGGAGATATGCGAAGGGCCCTGAATATTTTGCAG---------------TTTGGGAAGGTGACAGAGT--G
-G--M--K--A--L--I--T--L--S--S--G--D--M--R--R--A--L--N--I--L--Q-----------------F--G--K--V--T--E--\--

-----------------------------------------------------------------------------------------------><---
E--T--V--Y--T--C--T--G--H--P--L--K--S--D--I--A--N--I--L--D--W--M--L--N--Q--D--F--T--T--A--Y--R--N--I
AGACTGTCTACACCTGCACCGGGCACCCGCTCAAGTCAGACATTGCCAACATCCTGGACTGGATGTTGAATCAAGATTTCACCACAGCCTACAGAAATAT
::::.:: ::::::::::: ::::::::.::::::::::::::.::::::::.::.:::::::::::::::::.:::::::::::.::::::      ::
AGACCGTGTACACCTGCACAGGGCACCCACTCAAGTCAGACATCGCCAACATTCTAGACTGGATGTTGAATCAGGATTTCACCACGGCCTAC------AT
E--T--V--Y--T--C--T--G--H--P--L--K--S--D--I--A--N--I--L--D--W--M--L--N--Q--D--F--T--T--A--Y--------I

-------------------------------------------------------------------------><-------------------------
--T--E--L--K--T--L--K--G--L--A--L--H--D--I--L--T--E--I--H--L--F--V--H--R--V--D--F--P--S--S--V--R--I-
TACAGAGTTGAAAACTCTGAAGGGGTTGGCACTGCATGATATCCTGACAGAGATACACTTGTTTGTGCATAGAGTTGACTTTCCATCTTCAGTTCGAATA
::..::::::::::::::::::::..:::::.:. ::::.::::::::.::::::::::::::::::::.:::   ::::::::::::::::::::::::
TATGGAGTTGAAAACTCTGAAGGGACTGGCATTAAATGACATCCTGACGGAGATACACTTGTTTGTGCACAGA---GACTTTCCATCTTCAGTTCGAATA
--M--E--L--K--T--L--K--G--L--A--L--N--D--I--L--T--E--I--H--L--F--V--H--R-----D--F--P--S--S--V--R--I-

----------------------------><----------------------------------------------------------------------
-H--L--L--T--K--M--A--D--I--E--Y--R--L--S--V--G--T--N--E--K--I--Q--L--S--S--L--I--A--A--F--Q--V--T--
CATTTATTGACCAAAATGGCAGACATTGAGTACAGGCTTTCTGTTGGCACCAACGAGAAGATCCAGCTGAGCTCCCTCATTGCTGCATTTCAAGTCACCA
:::::::::::::::::::::::::::                                                                         
CATTTATTGACCAAAATGGCAGACATT-------------------------------------------------------------------------
-H--L--L--T--K--M--A--D--I--------------------------------------------------------------------------

------------------------->
R--D--L--I--V--A--E--A--*-
GAGACCTGATTGTTGCAGAGGCCTAG
                          
--------------------------
--------------------------

Pig Consensus Sequence

>BGISUST0000883669
ATGCAGACCTCAGCGCACAAGCAGCAGCAGCAGCCCGAGGCAACCAAGATCAGGAACCTGCCC---GTTGAAAAATACCGGCCACAGACACTGGATGATC
TCATTTCTCATCAGGACATTCTGAGT------CAGAAGTTTATCAGTGAGGACCGCCTTCCGCACCTCCTTCTCTATGGTCCTCCAGGCACGGGAAAGAC
ATCCACCATCCTGGCCTGTGCTAAACAGCTGTACAAAGATAAGGAATTCGGCTCCATGGTCTTGGAGCTGAATGCTTCAGATGACCGAGGAATAGATATC
GTTCGGGGACCAATCCTGAGCTTTGCTAGCACAAGGACAATATTT---AAGGGCTTTAAACTAGTGATCTTGGATGAAGCTGATGCCATGACTCAGGATG
CCCAGAACGCCTTGCGGAGA---ATTGAAAAATTTACTGAAAATACCAGATTTTGCCTCATCTGCAACTATCTGTCAAAGATCATTCCCGCCTTGCAGTC
CCGGTGTACAAGGTTCCGATTCGGCCCCCTGACTCCTGAACTCATGGTTCCCCGCCTGGAACATGTTGTAGAAGAAGAG---GTTGATATAAGCGAAGAT
GGGATGAAAGCGCTCATAACACTTTCCAGTGGAGATATGCGAAGGGCCCTGAATATTTTGCAG---------------TTTGGGAAGGTGACAGAggAGA
CCGTGTACACCTGCACAGGGCACCCACTCAAGTCAGACATCGCCAACATTCTAGACTGGATGTTGAATCAGGATTTCACCACGGCCTAC------ATTAT
GGAGTTGAAAACTCTGAAGGGACTGGCATTAAATGACATCCTGACGGAGATACACTTGTTTGTGCACAGA---GACTTTCCATCTTCAGTTCGAATACAT
TTATTGACCAAAATGGCAGACATT----------------------------------------------------------------------------
-----------------------


>BGISUSP0000883669
MQTSAHKQQQQPEATKIRNLP-VEKYRPQTLDDLISHQDILS--QKFISEDRLPHLLLYGPPGTGKTSTILACAKQLYKDKEFGSMVLELNASDDRGIDI
VRGPILSFASTRTIF-KGFKLVILDEADAMTQDAQNALRR-IEKFTENTRFCLICNYLSKIIPALQSRCTRFRFGPLTPELMVPRLEHVVEEE-VDISED
GMKALITLSSGDMRRALNILQ-----FGKVTEETVYTCTGHPLKSDIANILDWMLNQDFTTAY--IMELKTLKGLALNDILTEIHLFVHR-DFPSSVRIH
LLTKMADI---------------------------------