Sequences
EST Library Info
cbl1Blood
fat6Fatt
fbs3Unavailable
lnt2Lymphatic nodule tracheobroncalis
nep6Newborn 115 days, epidermis
pldo3Unavailable
spc1Spinal cord
spl2Spleen
Clusters
Oligos
SNPs

Gene ID ENSG00000111581 (click for geneview)
Transcript ID ENST00000229179(link to ensembl)
Symbol NUP107
Localtion Chromosome:12:67366998:67422732:1 band: 12q15
Description Nuclear pore complex protein Nup107 (Nucleoporin Nup107) (107 kDa nucleoporin). [Source:Uniprot/SWISSPROT;Acc:P57740]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<------><------------------------------------------------------------------------------------------>
-M--D--R--S--G--F--G--E--I--S--S--P--V--I--R--E--A--E--V--T--R--T--A--R--K--Q--S--A--Q--K--R--V--L--
ATGGACAGGAGTGGCTTTGGAGAGATATCATCCCCTGTAATCCGGGAGGCAGAGGTGACACGGACTGCACGGAAACAGAGTGCTCAGAAAAGAGTTTTAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

<-------------------------------------------------------------------------------------><------------
L--Q--A--S--Q--D--E--N--F--G--N--T--T--P--R--N--Q--V--I--P--R--T--P--S--S--F--R--Q--P--F--T--P--T--S
TTCAGGCATCTCAAGATGAAAATTTTGGTAATACTACACCAAGAAACCAGGTTATCCCTCGAACTCCTAGCTCATTTCGACAGCCTTTTACCCCAACAAG
  :.::::::.:::::::::: ::::. :::::::::::::::::::::::::::.::.::::::::.::::::::::::: .:::   ::.::: :::.
--CGGGCATCCCAAGATGAAATTTTTACTAATACTACACCAAGAAACCAGGTTATTCCCCGAACTCCCAGCTCATTTCGACCACCT---ACTCCACCAAA
---R--A--S--Q--D--E--I--F--T--N--T--T--P--R--N--Q--V--I--P--R--T--P--S--S--F--R--P--P-----T--P--P--N

----------------------------------------------------------------------------------------------------
--R--S--L--L--R--Q--P--D--I--S--C--I--L--G--T--G--G--K--S--P--R--L--T--Q--S--S--G--F--F--G--N--L--S-
CCGAAGCTTACTAAGGCAGCCAGATATTTCCTGCATTCTTGGAACAGGAGGGAAGTCGCCCCGACTTACGCAGTCTTCAGGGTTCTTTGGAAATCTCTCC
::::::::::::::::::.::::::..:::: :::::.::::::: :::::::.::: :::::.:::::.:::::::: :::::::: :::::::: ::.
CCGAAGCTTACTAAGGCAACCAGATGCTTCCAGCATTTTTGGAACTGGAGGGAGGTCTCCCCGGCTTACACAGTCTTCTGGGTTCTTGGGAAATCTGTCT
--R--S--L--L--R--Q--P--D--A--S--S--I--F--G--T--G--G--R--S--P--R--L--T--Q--S--S--G--F--L--G--N--L--S-

--><------------------------------------------------------------------------------------------------
-M--V--T--N--L--D--D--S--N--W--A--A--A--F--S--S--Q--R--S--G--L--F--T--N--T--E--P--H--S--I--T--E--D--
ATGGTTACTAATCTGGATGACAGTAACTGGGCAGCTGCATTTTCATCACAGCGTTCCGGGCTGTTCACAAACACAGAGCCCCACAGTATAACAGAAGATG
:::::.:::::.::::::::.::::::::::: ::::::::.:::::.:::::: : ::::: ::::: ::::::::::::::::::.:::::::.::::
ATGGTCACTAACCTGGATGATAGTAACTGGGCTGCTGCATTCTCATCGCAGCGTGCAGGGCTCTTCACCAACACAGAGCCCCACAGTGTAACAGAGGATG
-M--V--T--N--L--D--D--S--N--W--A--A--A--F--S--S--Q--R--A--G--L--F--T--N--T--E--P--H--S--V--T--E--D--

-----------------------------------------------><---------------------------------------------------
V--T--I--S--A--V--M--L--R--E--D--D--P--G--E--A--A--S--M--S--M--F--S--D--F--L--Q--S--F--L--K--H--S--S
TAACTATCAGTGCTGTTATGTTACGTGAGGATGATCCTGGAGAAGCTGCATCCATGAGTATGTTTTCTGATTTCCTGCAGTCTTTTCTGAAGCACTCTTC
::::. :.:::::::::::::::::::::::::::::::::::::::   ::::::::.:::::::::::::::::::::::::::.:::::::::::::
TAACCCTTAGTGCTGTTATGTTACGTGAGGATGATCCTGGAGAAGCT---TCCATGAGCATGTTTTCTGATTTCCTGCAGTCTTTTTTGAAGCACTCTTC
V--T--L--S--A--V--M--L--R--E--D--D--P--G--E--A-----S--M--S--M--F--S--D--F--L--Q--S--F--L--K--H--S--S

---------------------------------------------------><-----------------------------------------------
--S--T--V--F--D--L--V--E--E--Y--E--N--I--C--G--S--Q--V--N--I--L--S--K--I--V--S--R--A--T--P--G--L--Q-
GAGTACAGTTTTTGATCTTGTGGAAGAGTATGAAAACATCTGTGGTAGTCAGGTGAATATACTGAGTAAAATAGTGAGTCGAGCAACACCTGGACTTCAA
.: :::.:::::::: :::::.:::::::::::::::::.:::.::::::::::::::::::::::::::::::::::.::::::::::::::::::::.
AACTACGGTTTTTGAACTTGTAGAAGAGTATGAAAACATTTGTAGTAGTCAGGTGAATATACTGAGTAAAATAGTGAGCCGAGCAACACCTGGACTTCAG
--T--T--V--F--E--L--V--E--E--Y--E--N--I--C--S--S--Q--V--N--I--L--S--K--I--V--S--R--A--T--P--G--L--Q-

-------------------------------------------------------------------------------><-------------------
-K--F--S--K--T--A--S--M--L--W--L--L--Q--Q--E--M--V--T--W--R--L--L--A--S--L--Y--R--D--R--I--Q--S--A--
AAATTTTCAAAAACAGCCAGTATGCTCTGGCTTCTTCAACAGGAGATGGTCACATGGAGGCTGCTGGCTTCTTTGTATAGAGACAGAATACAGTCTGCAT
::.:::::::::::::::::::::::::::::::::::::::::.::::::::.::: ::::::::::::: ::::::   :::::::::::::::::::
AAGTTTTCAAAAACAGCCAGTATGCTCTGGCTTCTTCAACAGGAAATGGTCACGTGGCGGCTGCTGGCTTCGTTGTAT---GACAGAATACAGTCTGCAT
-K--F--S--K--T--A--S--M--L--W--L--L--Q--Q--E--M--V--T--W--R--L--L--A--S--L--Y-----D--R--I--Q--S--A--

----------------------------><----------------------------------------------------------------------
L--E--E--E--S--V--F--A--V--T--A--V--N--A--S--E--K--T--V--V--E--A--L--F--Q--R--D--S--L--V--R--Q--S--Q
TAGAAGAGGAAAGTGTATTCGCAGTTACTGCTGTTAATGCCAGTGAAAAAACAGTTGTGGAAGCGTTATTTCAGAGGGATTCACTTGTTCGACAAAGTCA
::::::: ::::.:.::::.:::::::::::: :::::::::::::::::.:::::::::::::.:::::::::::::::::::::::.:::::: ::::
TAGAAGATGAAAATATATTTGCAGTTACTGCTTTTAATGCCAGTGAAAAAGCAGTTGTGGAAGCATTATTTCAGAGGGATTCACTTGTCCGACAATGTCA
L--E--D--E--N--I--F--A--V--T--A--F--N--A--S--E--K--A--V--V--E--A--L--F--Q--R--D--S--L--V--R--Q--C--Q

><---------------------------------------------------------------------------------------><---------
--L--V--V--D--W--L--E--S--I--A--K--D--E--I--G--E--F--S--D--N--I--E--F--Y--A--K--S--V--Y--W--E--N--T-
GCTGGTGGTAGATTGGTTAGAGAGTATTGCCAAAGATGAAATTGGAGAATTTTCTGATAATATTGAGTTTTATGCAAAATCAGTATATTGGGAAAATACT
:::::::::.::::::::::::::.::::::::::::::.:::::::: :::::::::::::::::::::::::::::::::::::::   :::::::::
GCTGGTGGTGGATTGGTTAGAGAGCATTGCCAAAGATGAGATTGGAGATTTTTCTGATAATATTGAGTTTTATGCAAAATCAGTATAT---GAAAATACT
--L--V--V--D--W--L--E--S--I--A--K--D--E--I--G--D--F--S--D--N--I--E--F--Y--A--K--S--V--Y-----E--N--T-

--------------------------------------------------------------------><------------------------------
-L--H--T--L--K--Q--R--Q--L--T--S--Y--V--G--S--V--R--P--L--V--T--E--L--D--P--D--A--P--I--R--Q--K--M--
CTGCATACCTTAAAACAACGGCAGCTGACTTCTTACGTTGGAAGTGTTCGTCCGCTTGTCACTGAATTGGACCCTGATGCTCCCATAAGACAGAAAATGC
:::::::::.:.:::::.::::::::. :::::::..: ::::::::.::::: :::::::::::::::::.::::::::::::::::::::::::::::
CTGCATACCCTGAAACAGCGGCAGCTACCTTCTTATATAGGAAGTGTCCGTCCTCTTGTCACTGAATTGGATCCTGATGCTCCCATAAGACAGAAAATGC
-L--H--T--L--K--Q--R--Q--L--P--S--Y--I--G--S--V--R--P--L--V--T--E--L--D--P--D--A--P--I--R--Q--K--M--

----------------------------------------------------------------------------------><----------------
P--L--D--D--L--D--R--E--D--E--V--R--L--L--K--Y--L--F--T--L--I--R--A--G--M--T--E--E--A--Q--R--L--C--K
CCCTTGATGATCTGGATAGAGAAGATGAAGTTAGATTACTCAAATATCTCTTTACTCTAATCCGTGCTGGAATGACAGAAGAGGCACAACGACTCTGTAA
::::.::::::::::::::::::::::::::.::::::::::::::::::::.::::: ::.:::::::::::::::::::::::::::::::::::.::
CCCTCGATGATCTGGATAGAGAAGATGAAGTCAGATTACTCAAATATCTCTTCACTCTCATTCGTGCTGGAATGACAGAAGAGGCACAACGACTCTGCAA
P--L--D--D--L--D--R--E--D--E--V--R--L--L--K--Y--L--F--T--L--I--R--A--G--M--T--E--E--A--Q--R--L--C--K

-------------------------------------------------------------------------><-------------------------
--R--C--G--Q--A--W--R--A--A--T--L--E--G--W--K--L--Y--H--D--P--N--V--N--G--G--T--E--L--E--P--V--E--G-
ACGCTGTGGTCAAGCATGGAGAGCTGCAACACTTGAAGGCTGGAAACTGTACCATGACCCTAATGTTAATGGAGGAACAGAATTAGAACCTGTTGAAGGG
.::.::::::::.::::::::::::::::::::::::::::::::::: :::::::::::.::::::::::::   ::::::::::::::::::::::::
GCGTTGTGGTCAGGCATGGAGAGCTGCAACACTTGAAGGCTGGAAACTCTACCATGACCCCAATGTTAATGGA---ACAGAATTAGAACCTGTTGAAGGG
--R--C--G--Q--A--W--R--A--A--T--L--E--G--W--K--L--Y--H--D--P--N--V--N--G-----T--E--L--E--P--V--E--G-

--------------------------------------------------><------------------------------------------------
-N--P--Y--R--R--I--W--K--I--S--C--W--R--M--A--E--D--E--L--F--N--R--Y--E--R--A--I--Y--A--A--L--S--G--
AATCCATATAGACGCATTTGGAAAATAAGTTGCTGGAGAATGGCAGAAGATGAGCTTTTTAATAGATACGAGAGAGCAATTTATGCAGCTTTAAGTGGGA
::::: ::: ::.:::::::::::::::::::.:::::.::::::::::::::.: ::::::::::::::::::::::::::::::::::::::::::::
AATCCTTATCGATGCATTTGGAAAATAAGTTGTTGGAGGATGGCAGAAGATGAACATTTTAATAGATACGAGAGAGCAATTTATGCAGCTTTAAGTGGGA
-N--P--Y--R--C--I--W--K--I--S--C--W--R--M--A--E--D--E--H--F--N--R--Y--E--R--A--I--Y--A--A--L--S--G--

----------><----------------------------------------------------------------------------------------
N--L--K--Q--L--L--P--V--C--D--T--W--E--D--T--V--W--A--Y--F--R--V--M--V--D--S--L--V--E--Q--E--I--Q--T
ATCTTAAGCAGCTGCTTCCTGTCTGTGACACCTGGGAAGACACAGTTTGGGCCTACTTCCGGGTGATGGTGGACAGTCTGGTAGAACAGGAGATCCAGAC
::::.::::::::::::::::::::::::::::::::.::.::::: :::::::::::.:::::::::::::::::::::::::::::::::::::..::
ATCTCAAGCAGCTGCTTCCTGTCTGTGACACCTGGGAGGATACAGTGTGGGCCTACTTTCGGGTGATGGTGGACAGTCTGGTAGAACAGGAGATCCGAAC
N--L--K--Q--L--L--P--V--C--D--T--W--E--D--T--V--W--A--Y--F--R--V--M--V--D--S--L--V--E--Q--E--I--R--T

--------------------------------------------------------><------------------------------------------
--S--V--A--T--L--D--E--T--E--E--L--P--R--E--Y--L--G--A--N--W--T--L--E--K--V--F--E--E--L--Q--A--T--D-
ATCAGTAGCAACTCTGGATGAAACTGAAGAACTCCCTAGAGAATATCTGGGAGCAAACTGGACGTTAGAAAAGGTTTTTGAGGAACTTCAAGCTACTGAC
:::::::...::::::::::::::::::::::::::::::::::::.::         ::::: :::::::::::::::::.:::::::::::::::::.
ATCAGTAATGACTCTGGATGAAACTGAAGAACTCCCTAGAGAATATTTG---------TGGACCTTAGAAAAGGTTTTTGAAGAACTTCAAGCTACTGAT
--S--V--M--T--L--D--E--T--E--E--L--P--R--E--Y--L-----------W--T--L--E--K--V--F--E--E--L--Q--A--T--D-

-----><--------------------------------------------------------------------><-----------------------
-K--K--R--V--L--E--E--N--Q--E--H--Y--H--I--V--Q--K--F--L--I--L--G--D--I--D--G--L--M--D--E--F--S--K--
AAAAAGAGAGTTCTGGAAGAGAATCAAGAACATTATCATATAGTTCAAAAGTTTCTTATCCTGGGAGACATTGATGGTTTGATGGATGAGTTTAGCAAAT
::::::::::::::::::::::::::::::::::::::::::::::::::.::.:::::::: ::::::::::::   :::::::::::.::::::::::
AAAAAGAGAGTTCTGGAAGAGAATCAAGAACATTATCATATAGTTCAAAAATTCCTTATCCTTGGAGACATTGAT---TTGATGGATGAATTTAGCAAAT
-K--K--R--V--L--E--E--N--Q--E--H--Y--H--I--V--Q--K--F--L--I--L--G--D--I--D-----L--M--D--E--F--S--K--

----------------------------------------------------------------------------------------------><----
W--L--S--K--S--R--N--N--L--P--G--H--L--L--R--F--M--T--H--L--I--L--F--F--R--T--L--G--L--Q--T--K--E--E
GGCTTTCCAAAAGCAGAAACAATCTACCTGGACACCTGCTTCGCTTTATGACTCACCTTATTTTGTTTTTCCGTACTCTGGGACTACAGACCAAGGAGGA
::::::::::.:::::::::::::::::::::::::: ::.:::::.:::::::::::.::::::::::::::.:::::::::::.::::::        
GGCTTTCCAAGAGCAGAAACAATCTACCTGGACACCTTCTCCGCTTCATGACTCACCTCATTTTGTTTTTCCGCACTCTGGGACTGCAGACC--------
W--L--S--K--S--R--N--N--L--P--G--H--L--L--R--F--M--T--H--L--I--L--F--F--R--T--L--G--L--Q--T---------

---------------------------------><-----------------------------------------------------------------
--V--S--I--E--V--L--K--T--Y--I--Q--L--L--I--R--E--K--H--T--N--L--I--A--F--Y--T--C--H--L--P--Q--D--L-
AGTTTCTATTGAAGTTTTAAAGACATACATACAGCTTTTAATAAGAGAGAAACATACAAATCTTATAGCATTTTATACCTGTCATTTGCCTCAAGACCTA
                                  ::::::::::. :::::.::::::.::::.::::::::::::::::::::::::::::::::::::
----------------------------------CTTTTAATAAATGAGAAGCATACAGATCTCATAGCATTTTATACCTGTCATTTGCCTCAAGACCTA
-----------------------------------L--L--I--N--E--K--H--T--D--L--I--A--F--Y--T--C--H--L--P--Q--D--L-

------------------------------------------------------------------------------------><--------------
-A--V--A--Q--Y--A--L--F--L--E--S--V--T--E--F--E--Q--R--H--H--C--L--E--L--A--K--E--A--D--L--D--V--A--
GCTGTTGCCCAGTATGCATTATTTTTGGAAAGTGTTACAGAATTTGAACAGCGCCACCATTGCCTGGAGTTGGCTAAAGAAGCAGATTTGGATGTTGCAA
::::: ::::::::::::.:::::::::::.::::::::::::::::::::::::::::::::::::::.::::::::::::::   ::::::.::::::
GCTGTGGCCCAGTATGCACTATTTTTGGAAGGTGTTACAGAATTTGAACAGCGCCACCATTGCCTGGAGCTGGCTAAAGAAGCA---TTGGATATTGCAA
-A--V--A--Q--Y--A--L--F--L--E--G--V--T--E--F--E--Q--R--H--H--C--L--E--L--A--K--E--A-----L--D--I--A--

-------------------------------------------------------------------------------------------------><-
T--I--T--K--T--V--V--E--N--I--R--K--K--D--N--G--E--F--S--H--H--D--L--A--P--A--L--D--T--G--T--T--E--E
CAATAACAAAAACTGTAGTTGAGAATATTCGAAAGAAAGATAATGGTGAATTTAGTCATCATGACCTGGCCCCAGCCCTAGATACTGGCACTACTGAGGA
: :::::::::::::::::::::::::.::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::: :::  
CTATAACAAAAACTGTAGTTGAGAATACTCGAAAGAAAGATAATGGTGAATTCAGTCATCATGACCTGGCCCCAGCCCTAGATACTGGCACTACAGAG--
T--I--T--K--T--V--V--E--N--T--R--K--K--D--N--G--E--F--S--H--H--D--L--A--P--A--L--D--T--G--T--T--E---

----------------------------------------------------------------------------------------------------
--D--R--L--K--I--D--V--I--D--W--L--V--F--D--P--A--Q--R--A--E--A--L--K--Q--G--N--A--I--M--R--K--F--L-
GGATCGTTTAAAAATTGATGTAATTGACTGGTTGGTATTTGACCCAGCGCAGAGGGCAGAAGCACTGAAACAAGGCAATGCAATTATGAGAAAATTCTTG
                      ::::::::::::::::::::::::::.:::::.::.::::::::.::::::::::::::.:: :::::.::::::   
----------------------ATTGACTGGTTGGTATTTGACCCAGCACAGAGAGCGGAAGCACTAAAACAAGGCAATGCGATAATGAGGAAATTC---
-----------------------I--D--W--L--V--F--D--P--A--Q--R--A--E--A--L--K--Q--G--N--A--I--M--R--K--F----

><--------------------------------------------------------------------------------------------------
-A--S--K--K--H--E--A--A--K--E--V--F--V--K--I--P--Q--D--S--I--A--E--I--Y--N--Q--C--E--E--Q--G--M--E--
GCATCAAAAAAGCACGAAGCTGCAAAAGAAGTATTTGTGAAAATTCCTCAGGATTCTATAGCAGAAATCTATAATCAGTGCGAGGAACAAGGAATGGAAA
   ::::::::.:::::::::::::::::::::::.:::::::::::::::::::: ::::::::::::::::::::.:: :::::::::::::::::.:
---TCAAAAAAACACGAAGCTGCAAAAGAAGTATTCGTGAAAATTCCTCAGGATTCAATAGCAGAAATCTATAATCAATGGGAGGAACAAGGAATGGAGA
----S--K--K--H--E--A--A--K--E--V--F--V--K--I--P--Q--D--S--I--A--E--I--Y--N--Q--W--E--E--Q--G--M--E--

-------------------------------------------------------------><-------------------------------------
S--P--L--P--A--E--D--D--N--A--I--R--E--H--L--C--I--R--A--Y--L--E--A--H--E--T--F--N--E--W--F--K--H--M
GTCCACTTCCTGCTGAAGATGATAATGCTATCCGAGAACATTTGTGCATCAGAGCTTATTTGGAAGCCCATGAAACCTTTAATGAGTGGTTTAAGCATAT
:.:::::::::::::::::::::::.::.::::::::::::::::::::.::::::::.:::::::::::::::::::::::::::::::::::::::::
GCCCACTTCCTGCTGAAGATGATAACGCCATCCGAGAACATTTGTGCATTAGAGCTTACTTGGAAGCCCATGAAACCTTTAATGAGTGGTTTAAGCATAT
S--P--L--P--A--E--D--D--N--A--I--R--E--H--L--C--I--R--A--Y--L--E--A--H--E--T--F--N--E--W--F--K--H--M

---------------------------------------------------------------------------------------><-----------
--N--S--V--P--Q--K--P--A--L--I--P--Q--P--T--F--T--E--K--V--A--H--E--H--K--E--K--K--Y--E--M--D--F--G-
GAATTCAGTTCCACAAAAACCTGCTTTGATACCTCAACCAACTTTTACTGAGAAAGTGGCTCATGAACACAAAGAAAAGAAATATGAAATGGATTTTGGT
::::::::.:::::::::::::.:::::::::::::: ::::::::::::::::::::::::::::::::::::::::::::::.:::::::::: .:: 
GAATTCAGCTCCACAAAAACCTACTTTGATACCTCAAGCAACTTTTACTGAGAAAGTGGCTCATGAACACAAAGAAAAGAAATACGAAATGGATTACGGA
--N--S--A--P--Q--K--P--T--L--I--P--Q--A--T--F--T--E--K--V--A--H--E--H--K--E--K--K--Y--E--M--D--Y--G-

----------------------------------------------------------------------------------------------------
-I--W--K--G--H--L--D--A--L--T--A--D--V--K--E--K--M--Y--N--V--L--L--F--V--D--G--G--W--M--V--D--V--R--
ATTTGGAAAGGGCATTTGGATGCCCTAACTGCTGATGTGAAGGAGAAAATGTATAACGTCTTGTTGTTTGTTGATGGAGGGTGGATGGTGGATGTTAGAG
::::::::::::::.::::::::::: ::::::::::::::::::::::::::.::.::::::::::::::::::::::::::::::::.::::::::::
ATTTGGAAAGGGCACTTGGATGCCCTCACTGCTGATGTGAAGGAGAAAATGTACAATGTCTTGTTGTTTGTTGATGGAGGGTGGATGGTAGATGTTAGAG
-I--W--K--G--H--L--D--A--L--T--A--D--V--K--E--K--M--Y--N--V--L--L--F--V--D--G--G--W--M--V--D--V--R--

-><-------------------------------------------------------------------------------------------------
E--D--A--K--E--D--H--E--R--T--H--Q--M--V--L--L--R--K--L--C--L--P--M--L--C--F--L--L--H--T--I--L--H--S
AGGATGCCAAAGAAGACCATGAAAGAACACATCAAATGGTCTTACTGAGAAAGCTTTGTCTGCCAATGTTGTGTTTTCTGCTTCATACGATATTGCACAG
:::::::..:.:::::::::::::::::::::::::::::. :::::::: :::::::::::::::::::::::::::::::.::.:: ::::::::.::
AGGATGCTGAGGAAGACCATGAAAGAACACATCAAATGGTTGTACTGAGACAGCTTTGTCTGCCAATGTTGTGTTTTCTGCTCCACACCATATTGCATAG
E--D--A--E--E--D--H--E--R--T--H--Q--M--V--V--L--R--Q--L--C--L--P--M--L--C--F--L--L--H--T--I--L--H--S

---------------------------------------------------------------------><-----------------------------
--T--G--Q--Y--Q--E--C--L--Q--L--A--D--M--V--S--S--E--R--H--K--L--Y--L--V--F--S--K--E--E--L--R--K--L-
TACTGGTCAGTATCAGGAATGCCTACAGTTAGCAGATATGGTATCCTCTGAGCGCCACAAACTGTACCTGGTATTTTCTAAGGAAGAGCTAAGGAAGTTG
::::::::::::::::::::::::.:::::::::::::::::.:::::::::::::::::.:::::.::::::::::::::::::::.::::::::.:::
TACTGGTCAGTATCAGGAATGCCTGCAGTTAGCAGATATGGTGTCCTCTGAGCGCCACAAGCTGTATCTGGTATTTTCTAAGGAAGAACTAAGGAAATTG
--T--G--Q--Y--Q--E--C--L--Q--L--A--D--M--V--S--S--E--R--H--K--L--Y--L--V--F--S--K--E--E--L--R--K--L-

----------------------------------------------------------------------------->
-L--Q--K--L--R--E--S--S--L--M--L--L--D--Q--G--L--D--P--L--G--Y--E--I--Q--L--*-
CTGCAGAAGCTCAGAGAGTCCTCTCTAATGCTCCTAGACCAGGGACTTGACCCATTAGGGTATGAAATTCAGTTATAG
:: ::::::.: :::::.::::::::::::::::::::::::::::::::.:: .::::.:::::::::::.      
CTTCAGAAGTTAAGAGAATCCTCTCTAATGCTCCTAGACCAGGGACTTGATCCTCTAGGATATGAAATTCAA------
-L--Q--K--L--R--E--S--S--L--M--L--L--D--Q--G--L--D--P--L--G--Y--E--I--Q-------

Pig Consensus Sequence

>BGISUST0000878710
----------------------------------------------------------------------------------------------------
--CGGGCATCCCAAGATGAAATTTTTACTAATACTACACCAAGAAACCAGGTTATTCCCCGAACTCCCAGCTCATTTCGACCACCT---ACTCCACCAAA
CCGAAGCTTACTAAGGCAACCAGATGCTTCCAGCATTTTTGGAACTGGAGGGAGGTCTCCCCGGCTTACACAGTCTTCTGGGTTCTTGGGAAATCTGTCT
ATGGTCACTAACCTGGATGATAGTAACTGGGCTGCTGCATTCTCATCGCAGCGTGCAGGGCTCTTCACCAACACAGAGCCCCACAGTGTAACAGAGGATG
TAACCCTTAGTGCTGTTATGTTACGTGAGGATGATCCTGGAGAAGCT---TCCATGAGCATGTTTTCTGATTTCCTGCAGTCTTTTTTGAAGCACTCTTC
AACTACGGTTTTTGAACTTGTAGAAGAGTATGAAAACATTTGTAGTAGTCAGGTGAATATACTGAGTAAAATAGTGAGCCGAGCAACACCTGGACTTCAG
AAGTTTTCAAAAACAGCCAGTATGCTCTGGCTTCTTCAACAGGAAATGGTCACGTGGCGGCTGCTGGCTTCGTTGTAT---GACAGAATACAGTCTGCAT
TAGAAGATGAAAATATATTTGCAGTTACTGCTTTTAATGCCAGTGAAAAAGCAGTTGTGGAAGCATTATTTCAGAGGGATTCACTTGTCCGACAATGTCA
GCTGGTGGTGGATTGGTTAGAGAGCATTGCCAAAGATGAGATTGGAGATTTTTCTGATAATATTGAGTTTTATGCAAAATCAGTATAT---GAAAATACT
CTGCATACCCTGAAACAGCGGCAGCTACCTTCTTATATAGGAAGTGTCCGTCCTCTTGTCACTGAATTGGATCCTGATGCTCCCATAAGACAGAAAATGC
CCCTCGATGATCTGGATAGAGAAGATGAAGTCAGATTACTCAAATATCTCTTCACTCTCATTCGTGCTGGAATGACAGAAGAGGCACAACGACTCTGCAA
GCGTTGTGGTCAGGCATGGAGAGCTGCAACACTTGAAGGCTGGAAACTCTACCATGACCCCAATGTTAATGGA---ACAGAATTAGAACCTGTTGAAGGG
AATCCTTATCGATGCATTTGGAAAATAAGTTGTTGGAGGATGGCAGAAGATGAACATTTTAATAGATACGAGAGAGCAATTTATGCAGCTTTAAGTGGGA
ATCTCAAGCAGCTGCTTCCTGTCTGTGACACCTGGGAGGATACAGTGTGGGCCTACTTTCGGGTGATGGTGGACAGTCTGGTAGAACAGGAGATCCGAAC
ATCAGTAATGACTCTGGATGAAACTGAAGAACTCCCTAGAGAATATTTG---------TGGACCTTAGAAAAGGTTTTTGAAGAACTTCAAGCTACTGAT
AAAAAGAGAGTTCTGGAAGAGAATCAAGAACATTATCATATAGTTCAAAAATTCCTTATCCTTGGAGACATTGAT---TTGATGGATGAATTTAGCAAAT
GGCTTTCCAAGAGCAGAAACAATCTACCTGGACACCTTCTCCGCTTCATGACTCACCTCATTTTGTTTTTCCGCACTCTGGGACTGCAGACC--------
----------------------------------CTTTTAATAAATGAGAAGCATACAGATCTCATAGCATTTTATACCTGTCATTTGCCTCAAGACCTA
GCTGTGGCCCAGTATGCACTATTTTTGGAAGGTGTTACAGAATTTGAACAGCGCCACCATTGCCTGGAGCTGGCTAAAGAAGCA---TTGGATATTGCAA
CTATAACAAAAACTGTAGTTGAGAATACTCGAAAGAAAGATAATGGTGAATTCAGTCATCATGACCTGGCCCCAGCCCTAGATACTGGCACTACAGAG--
----------------------ATTGACTGGTTGGTATTTGACCCAGCACAGAGAGCGGAAGCACTAAAACAAGGCAATGCGATAATGAGGAAATTC---
---TCAAAAAAACACGAAGCTGCAAAAGAAGTATTCGTGAAAATTCCTCAGGATTCAATAGCAGAAATCTATAATCAATGGGAGGAACAAGGAATGGAGA
GCCCACTTCCTGCTGAAGATGATAACGCCATCCGAGAACATTTGTGCATTAGAGCTTACTTGGAAGCCCATGAAACCTTTAATGAGTGGTTTAAGCATAT
GAATTCAGCTCCACAAAAACCTACTTTGATACCTCAAGCAACTTTTACTGAGAAAGTGGCTCATGAACACAAAGAAAAGAAATACGAAATGGATTACGGA
ATTTGGAAAGGGCACTTGGATGCCCTCACTGCTGATGTGAAGGAGAAAATGTACAATGTCTTGTTGTTTGTTGATGGAGGGTGGATGGTAGATGTTAGAG
AGGATGCTGAGGAAGACCATGAAAGAACACATCAAATGGTTGTACTGAGACAGCTTTGTCTGCCAATGTTGTGTTTTCTGCTCCACACCATATTGCATAG
TACTGGTCAGTATCAGGAATGCCTGCAGTTAGCAGATATGGTGTCCTCTGAGCGCCACAAGCTGTATCTGGTATTTTCTAAGGAAGAACTAAGGAAATTG
CTTCAGAAGTTAAGAGAATCCTCTCTAATGCTCCTAGACCAGGGACTTGATCCTCTAGGATATGAAATTCAA------


>BGISUSP0000878710
----------------------------------RASQDEIFTNTTPRNQVIPRTPSSFRPP-TPPNRSLLRQPDASSIFGTGGRSPRLTQSSGFLGNLS
MVTNLDDSNWAAAFSSQRAGLFTNTEPHSVTEDVTLSAVMLREDDPGEA-SMSMFSDFLQSFLKHSSTTVFELVEEYENICSSQVNILSKIVSRATPGLQ
KFSKTASMLWLLQQEMVTWRLLASLY-DRIQSALEDENIFAVTAFNASEKAVVEALFQRDSLVRQCQLVVDWLESIAKDEIGDFSDNIEFYAKSVY-ENT
LHTLKQRQLPSYIGSVRPLVTELDPDAPIRQKMPLDDLDREDEVRLLKYLFTLIRAGMTEEAQRLCKRCGQAWRAATLEGWKLYHDPNVNG-TELEPVEG
NPYRCIWKISCWRMAEDEHFNRYERAIYAALSGNLKQLLPVCDTWEDTVWAYFRVMVDSLVEQEIRTSVMTLDETEELPREYL---WTLEKVFEELQATD
KKRVLEENQEHYHIVQKFLILGDID-LMDEFSKWLSKSRNNLPGHLLRFMTHLILFFRTLGLQT--------------LLINEKHTDLIAFYTCHLPQDL
AVAQYALFLEGVTEFEQRHHCLELAKEA-LDIATITKTVVENTRKKDNGEFSHHDLAPALDTGTTE--------IDWLVFDPAQRAEALKQGNAIMRKF-
-SKKHEAAKEVFVKIPQDSIAEIYNQWEEQGMESPLPAEDDNAIREHLCIRAYLEAHETFNEWFKHMNSAPQKPTLIPQATFTEKVAHEHKEKKYEMDYG
IWKGHLDALTADVKEKMYNVLLFVDGGWMVDVREDAEEDHERTHQMVVLRQLCLPMLCFLLHTILHSTGQYQECLQLADMVSSERHKLYLVFSKEELRKL
LQKLRESSLMLLDQGLDPLGYEIQ--