Sequences
EST Library Info
cbl3Blood
plac2Unavailable
plun2Unavailable
spl2Spleen
ssp2M. Supraspinatus
tes3Testes
Clusters
Oligos
SNPs

Gene ID ENSG00000111596 (click for geneview)
Transcript ID ENST00000229195(link to ensembl)
Symbol CNOT2
Localtion Chromosome:12:68923489:69033962:1 band: 12q15
Description CCR4-NOT transcription complex subunit 2 (CCR4-associated factor 2). [Source:Uniprot/SWISSPROT;Acc:Q9NZN8]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<----------------------------------------------><---------------------------------------------------
-M--V--R--T--D--G--H--T--L--S--E--K--R--N--Y--Q--V--T--N--S--M--F--G--A--S--R--K--K--F--V--E--G--V--
ATGGTGAGGACTGATGGACATACATTATCTGAGAAAAGAAACTACCAGGTGACAAACAGCATGTTTGGTGCTTCAAGAAAGAAGTTTGTAGAGGGGGTCG
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
ATGGTGAGGACTGATGGACATACATTATCTGAGAAAAGAAACTACCAGGTGACAAACAGCATGTTTGGTGCTTCAAGAAAGAAGTTTGTAGAGGGGGTCG
-M--V--R--T--D--G--H--T--L--S--E--K--R--N--Y--Q--V--T--N--S--M--F--G--A--S--R--K--K--F--V--E--G--V--

----------------------------------------------------------------------><----------------------------
D--S--D--Y--H--D--E--N--M--Y--Y--S--Q--S--S--M--F--P--H--R--S--E--K--D--M--L--A--S--P--S--T--S--G--Q
ACAGTGACTACCATGACGAAAACATGTACTACAGCCAGTCTTCTATGTTTCCACATCGGTCAGAAAAAGATATGCTGGCATCACCATCTACATCAGGTCA
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
ACAGTGACTACCATGACGAAAACATGTACTACAGCCAGTCTTCTATGTTTCCACATCGGTCAGAAAAAGATATGCTGGCATCACCATCTACATCAGGTCA
D--S--D--Y--H--D--E--N--M--Y--Y--S--Q--S--S--M--F--P--H--R--S--E--K--D--M--L--A--S--P--S--T--S--G--Q

-------------------------------------><-------------------------------------------------------------
--L--S--Q--F--G--A--S--L--Y--G--Q--Q--S--A--L--G--L--P--M--R--G--M--S--N--N--T--P--Q--L--N--R--S--L-
GCTGTCTCAGTTTGGGGCAAGTTTATACGGGCAACAAAGTGCACTAGGCCTTCCAATGAGGGGGATGAGCAACAATACCCCTCAGTTAAATCGCAGCTTA
:::::::::::::::::::::::::::::::::::::   ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
GCTGTCTCAGTTTGGGGCAAGTTTATACGGGCAACAA---GCACTAGGCCTTCCAATGAGGGGGATGAGCAACAATACCCCTCAGTTAAATCGCAGCTTA
--L--S--Q--F--G--A--S--L--Y--G--Q--Q-----A--L--G--L--P--M--R--G--M--S--N--N--T--P--Q--L--N--R--S--L-

-------------------------------------------------------------------------------------><-------------
-S--Q--G--T--Q--L--P--S--H--V--T--P--T--T--G--V--P--T--M--S--L--H--T--P--P--S--P--S--R--G--I--L--P--
TCACAAGGCACTCAGTTACCGAGCCACGTCACGCCAACAACAGGGGTACCAACAATGTCACTTCACACGCCTCCATCTCCAAGCAGGGGTATTTTGCCTA
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::   :::::::::::::
TCACAAGGCACTCAGTTACCGAGCCACGTCACGCCAACAACAGGGGTACCAACAATGTCACTTCACACGCCTCCATCTCCAAGC---GGTATTTTGCCTA
-S--Q--G--T--Q--L--P--S--H--V--T--P--T--T--G--V--P--T--M--S--L--H--T--P--P--S--P--S-----G--I--L--P--

----------------------------------------------------------------------------------------------------
M--N--P--R--N--M--M--N--H--S--Q--V--G--Q--G--I--G--I--P--S--R--T--N--S--M--S--S--S--G--L--G--S--P--N
TGAATCCTAGGAATATGATGAACCACTCCCAGGTTGGTCAGGGCATTGGAATTCCTAGCAGGACAAATAGCATGAGCAGTTCAGGGTTAGGTAGCCCCAA
:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.
TGAATCCTAGGAATATGATGAACCACTCCCAGGTTGGTCAGGGCATTGGAATTCCTAGCAGGACAAATAGCATGAGCAGTTCAGGGTTAGGTAGCCCCAG
M--N--P--R--N--M--M--N--H--S--Q--V--G--Q--G--I--G--I--P--S--R--T--N--S--M--S--S--S--G--L--G--S--P--S

--------------------------------------------------------------------><------------------------------
--R--S--S--P--S--I--I--C--M--P--K--Q--Q--P--S--R--Q--P--F--T--V--N--S--M--S--G--F--G--M--N--R--N--Q-
CAGAAGCTCGCCAAGCATAATATGTATGCCAAAGCAGCAGCCTTCTCGACAGCCTTTTACTGTGAACAGTATGTCTGGATTTGGAATGAACAGGAATCAG
:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::   ::::::::::::::::::::::::::::::
CAGAAGCTCGCCAAGCATAATATGTATGCCAAAGCAGCAGCCTTCTCGACAGCCTTTTACTGTGAAC---ATGTCTGGATTTGGAATGAACAGGAATCAG
--R--S--S--P--S--I--I--C--M--P--K--Q--Q--P--S--R--Q--P--F--T--V--N-----M--S--G--F--G--M--N--R--N--Q-

------------------------------------------------><--------------------------------------------------
-A--F--G--M--N--N--S--L--S--S--N--I--F--N--G--T--D--G--S--E--N--V--T--G--L--D--L--S--D--F--P--A--L--
GCATTTGGAATGAATAACTCCTTATCAAGTAACATTTTTAATGGAACAGACGGAAGTGAAAATGTGACAGGATTGGACCTTTCAGATTTCCCAGCATTAG
::::::::::::::::::::::::::::::::::::::::::::::::      :::::::::::::::::::::::::::::::::::.::::::::::
GCATTTGGAATGAATAACTCCTTATCAAGTAACATTTTTAATGGAACA------AGTGAAAATGTGACAGGATTGGACCTTTCAGATTTTCCAGCATTAG
-A--F--G--M--N--N--S--L--S--S--N--I--F--N--G--T--------S--E--N--V--T--G--L--D--L--S--D--F--P--A--L--

--------------------------------------------------------------------------><------------------------
A--D--R--N--R--R--E--G--S--G--N--P--T--P--L--I--N--P--L--A--G--R--A--P--Y--V--G--M--V--T--K--P--A--N
CAGACCGAAACAGGAGGGAAGGAAGTGGTAACCCAACTCCATTAATAAACCCCTTGGCTGGAAGAGCTCCTTATGTTGGAATGGTAACAAAACCAGCAAA
:::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::   :::::::::::::::::::::::
CAGACCGAAACAGAAGGGAAGGAAGTGGTAACCCAACTCCATTAATAAACCCCTTGGCTGGAAGAGCTCCTTAT---GGAATGGTAACAAAACCAGCAAA
A--D--R--N--R--R--E--G--S--G--N--P--T--P--L--I--N--P--L--A--G--R--A--P--Y-----G--M--V--T--K--P--A--N

----------------------------------------------------------------------------------------------------
--E--Q-----S--Q--D--F--S--I--H--N--E--D--F--P--A--L--P--G--S--S--Y--K--D--P--T--S--S--N--D--D--S--K-
TGAACAA---TCCCAGGACTTCTCAATACACAATGAAGATTTTCCAGCATTACCAGGCTCCAGCTATAAAGATCCAACATCAAGTAATGATGACAGTAAA
:::.:::    :::::::::::::::::::.::.:::::.:::::::::::::: ::.:::::.::::::::::::::::::::::::::::::::::::
TGAGCAAT--GCCCAGGACTTCTCAATACATAACGAAGACTTTCCAGCATTACCTGGTTCCAGTTATAAAGATCCAACATCAAGTAATGATGACAGTAAA
--E--Q--\--S--Q--D--F--S--I--H--N--E--D--F--P--A--L--P--G--S--S--Y--K--D--P--T--S--S--N--D--D--S--K-

--><------------------------------------------------------------------------------------------------
-S--N--L--N--T--S--G--K--T--T--S--S--T--D--G--P--K--F--P--G--D--K--S--S--T--T--Q--N--N--N--Q--Q--K--
TCTAATTTGAATACATCTGGCAAGACAACTTCAAGTACAGATGGACCCAAATTCCCTGGAGATAAAAGTTCAACAACACAAAATAATAACCAGCAGAAAA
:::::::::::::::::::::::::::: :::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::
TCTAATTTGAATACATCTGGCAAGACAAGTTCAAGTACAGATGGACCCAAATTCCCTGGAGATAAAAGTTCAACAACACAAAATAACAACCAGCAGAAAA
-S--N--L--N--T--S--G--K--T--S--S--S--T--D--G--P--K--F--P--G--D--K--S--S--T--T--Q--N--N--N--Q--Q--K--

-----------------------><---------------------------------------------------------------------------
K--G--I--Q--V--L--P--D--G--R--V--T--N--I--P--Q--G--M--V--T--D--Q--F--G--M--I--G--L--L--T--F--I--R--A
AAGGGATCCAGGTGTTACCTGATGGTCGGGTTACTAACATTCCTCAAGGGATGGTGACGGACCAATTTGGAATGATTGGCCTGTTAACATTTATCAGGGC
:::::::::::::::::::::::   ::::::::::::::::::::::: ::::::::::::::::::::::::::::::::::::::::::::::::::
AAGGGATCCAGGTGTTACCTGAT---CGGGTTACTAACATTCCTCAAGGTATGGTGACGGACCAATTTGGAATGATTGGCCTGTTAACATTTATCAGGGC
K--G--I--Q--V--L--P--D-----R--V--T--N--I--P--Q--G--M--V--T--D--Q--F--G--M--I--G--L--L--T--F--I--R--A

--------------------------------------------------------------------------------><------------------
--A--E--T--D--P--G--M--V--H--L--A--L--G--S--D--L--T--T--L--G--L--N--L--N--S--P--E--N--L--Y--P--K--F-
AGCAGAGACAGACCCAGGAATGGTACATCTTGCATTAGGAAGTGACTTAACAACATTAGGCCTCAATCTGAACTCTCCTGAAAATCTCTACCCCAAATTT
:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::   ::::::::::::::::::
AGCAGAGACAGACCCAGGAATGGTACATCTTGCATTAGGAAGTGACTTAACAACATTAGGCCTCAATCTGAACTCTCCT---AATCTCTACCCCAAATTT
--A--E--T--D--P--G--M--V--H--L--A--L--G--S--D--L--T--T--L--G--L--N--L--N--S--P-----N--L--Y--P--K--F-

------------------------------------------><------------------------------------------------><------
-A--S--P--W--A--S--S--P--C--R--P--Q--D--I--D--F--H--V--P--S--E--Y--L--T--N--I--H--I--R--D--K--L--A--
GCGTCACCCTGGGCATCTTCACCTTGTCGACCTCAAGACATAGACTTCCATGTTCCATCTGAGTACTTAACGAACATTCACATTAGGGATAAGCTGGCTG
::.:::::::::::::::                           :::::::::::::::::.::::::::::::::::::::::::      ::::: :
GCATCACCCTGGGCATCT---------------------------TTCCATGTTCCATCTGAATACTTAACGAACATTCACATTAGG------CTGGCGG
-A--S--P--W--A--S-----------------------------F--H--V--P--S--E--Y--L--T--N--I--H--I--R--------L--A--

---------------------------------------------------------------------------------------------><-----
A--I--K--L--G--R--Y--G--E--D--L--L--F--Y--L--Y--Y--M--N--G--G--D--V--L--Q--L--L--A--A--V--E--L--F--N
CAATAAAACTTGGCCGATATGGTGAAGACCTTCTCTTCTATCTCTATTACATGAATGGAGGAGACGTATTACAACTTTTAGCTGCAGTGGAGCTTTTTAA
::::::::::.::.:::::.:: :::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::   :::::
CAATAAAACTCGGTCGATACGGAGAAGATCTTCTCTTCTATCTCTATTACATGAATGGAGGAGACGTATTACAACTTTTAGCTGCAGTAGAG---TTTAA
A--I--K--L--G--R--Y--G--E--D--L--L--F--Y--L--Y--Y--M--N--G--G--D--V--L--Q--L--L--A--A--V--E-----F--N

----------------------------------------------------------------------------------------------------
--R--D--W--R--Y--H--K--E--E--R--V--W--I--T--R--A--P--G--M--E--P--T--M--K--T--N--T--Y--E--R--G--T--Y-
CCGTGATTGGAGATACCACAAAGAAGAACGAGTATGGATTACCAGGGCACCAGGCATGGAGCCAACAATGAAAACCAATACCTATGAGAGGGGAACATAT
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: ::::::::::::::::::
CCGTGATTGGAGATACCACAAAGAAGAACGAGTATGGATTACCAGGGCACCAGGCATGGAGCCAACAATGAAAACCAATACATATGAGAGGGGAACATAT
--R--D--W--R--Y--H--K--E--E--R--V--W--I--T--R--A--P--G--M--E--P--T--M--K--T--N--T--Y--E--R--G--T--Y-

--------------------------------------><------------------------------------------------------------
-Y--F--F--D--C--L--N--W--R--K--V--A--K--E--F--H--L--E--Y--D--K--L--E--E--R--P--H--L--P--S--T--F--N--
TACTTCTTTGACTGTCTTAACTGGAGGAAAGTAGCTAAGGAGTTCCATCTGGAATATGACAAATTAGAAGAACGGCCTCACCTGCCATCCACCTTCAACT
:::::::::                              :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
TACTTCTTT------------------------------GAGTTCCATCTGGAATATGACAAATTAGAAGAACGGCCTCACCTGCCATCCACCTTCAACT
-Y--F--F--------------------------------E--F--H--L--E--Y--D--K--L--E--E--R--P--H--L--P--S--T--F--N--

------------------------->
Y--N--P--A--Q--Q--A--F--*-
ACAACCCTGCTCAGCAAGCCTTCTAA
::::::::::::::::::::::::::
ACAACCCTGCTCAGCAAGCCTTCTAA
Y--N--P--A--Q--Q--A--F--*-

Pig Consensus Sequence

>BGISUST0000898771
ATGGTGAGGACTGATGGACATACATTATCTGAGAAAAGAAACTACCAGGTGACAAACAGCATGTTTGGTGCTTCAAGAAAGAAGTTTGTAGAGGGGGTCG
ACAGTGACTACCATGACGAAAACATGTACTACAGCCAGTCTTCTATGTTTCCACATCGGTCAGAAAAAGATATGCTGGCATCACCATCTACATCAGGTCA
GCTGTCTCAGTTTGGGGCAAGTTTATACGGGCAACAA---GCACTAGGCCTTCCAATGAGGGGGATGAGCAACAATACCCCTCAGTTAAATCGCAGCTTA
TCACAAGGCACTCAGTTACCGAGCCACGTCACGCCAACAACAGGGGTACCAACAATGTCACTTCACACGCCTCCATCTCCAAGC---GGTATTTTGCCTA
TGAATCCTAGGAATATGATGAACCACTCCCAGGTTGGTCAGGGCATTGGAATTCCTAGCAGGACAAATAGCATGAGCAGTTCAGGGTTAGGTAGCCCCAG
CAGAAGCTCGCCAAGCATAATATGTATGCCAAAGCAGCAGCCTTCTCGACAGCCTTTTACTGTGAAC---ATGTCTGGATTTGGAATGAACAGGAATCAG
GCATTTGGAATGAATAACTCCTTATCAAGTAACATTTTTAATGGAACA------AGTGAAAATGTGACAGGATTGGACCTTTCAGATTTTCCAGCATTAG
CAGACCGAAACAGAAGGGAAGGAAGTGGTAACCCAACTCCATTAATAAACCCCTTGGCTGGAAGAGCTCCTTAT---GGAATGGTAACAAAACCAGCAAA
TGAGCAagCCCAGGACTTCTCAATACATAACGAAGACTTTCCAGCATTACCTGGTTCCAGTTATAAAGATCCAACATCAAGTAATGATGACAGTAAATCT
AATTTGAATACATCTGGCAAGACAAGTTCAAGTACAGATGGACCCAAATTCCCTGGAGATAAAAGTTCAACAACACAAAATAACAACCAGCAGAAAAAAG
GGATCCAGGTGTTACCTGAT---CGGGTTACTAACATTCCTCAAGGTATGGTGACGGACCAATTTGGAATGATTGGCCTGTTAACATTTATCAGGGCAGC
AGAGACAGACCCAGGAATGGTACATCTTGCATTAGGAAGTGACTTAACAACATTAGGCCTCAATCTGAACTCTCCT---AATCTCTACCCCAAATTTGCA
TCACCCTGGGCATCT---------------------------TTCCATGTTCCATCTGAATACTTAACGAACATTCACATTAGG------CTGGCGGCAA
TAAAACTCGGTCGATACGGAGAAGATCTTCTCTTCTATCTCTATTACATGAATGGAGGAGACGTATTACAACTTTTAGCTGCAGTAGAG---TTTAACCG
TGATTGGAGATACCACAAAGAAGAACGAGTATGGATTACCAGGGCACCAGGCATGGAGCCAACAATGAAAACCAATACATATGAGAGGGGAACATATTAC
TTCTTT------------------------------GAGTTCCATCTGGAATATGACAAATTAGAAGAACGGCCTCACCTGCCATCCACCTTCAACTACA
ACCCTGCTCAGCAAGCCTTCTAA


>BGISUSP0000898771
MVRTDGHTLSEKRNYQVTNSMFGASRKKFVEGVDSDYHDENMYYSQSSMFPHRSEKDMLASPSTSGQLSQFGASLYGQQ-ALGLPMRGMSNNTPQLNRSL
SQGTQLPSHVTPTTGVPTMSLHTPPSPS-GILPMNPRNMMNHSQVGQGIGIPSRTNSMSSSGLGSPSRSSPSIICMPKQQPSRQPFTVN-MSGFGMNRNQ
AFGMNNSLSSNIFNGT--SENVTGLDLSDFPALADRNRREGSGNPTPLINPLAGRAPY-GMVTKPANEQAQDFSIHNEDFPALPGSSYKDPTSSNDDSKS
NLNTSGKTSSSTDGPKFPGDKSSTTQNNNQQKKGIQVLPD-RVTNIPQGMVTDQFGMIGLLTFIRAAETDPGMVHLALGSDLTTLGLNLNSP-NLYPKFA
SPWAS---------FHVPSEYLTNIHIR--LAAIKLGRYGEDLLFYLYYMNGGDVLQLLAAVE-FNRDWRYHKEERVWITRAPGMEPTMKTNTYERGTYY
FF----------EFHLEYDKLEERPHLPSTFNYNPAQQAF*