Sequences
EST Library Info
nlu1Newborn 115 days, lung
pigcb1Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000111725 (click for geneview)
Transcript ID ENST00000229328(link to ensembl)
Symbol PRKAB1
Localtion Chromosome:12:118568481:118582148:1 band: 12q24.23
Description 5'-AMP-activated protein kinase, beta-1 subunit (AMPK beta-1 chain) (AMPKb). [Source:Uniprot/SWISSPROT;Acc:Q9Y478]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--G--N--T--S--S--E--R--A--A--L--E--R--H--G--G--H--K--T--P--R--R--D--S--S--G--G--T--K--D--G--D--R--
ATGGGCAATACCAGCAGTGAGCGCGCCGCGCTGGAGCGGCATGGTGGCCATAAGACGCCCCGGAGGGACAGCTCGGGGGGCACCAAGGACGGGGACAGGC
:::::.::::: ::::::::::::::.:::::::: ::::: :: ::.::.::::: :::::.::::::::.::::::::: :::::::.:::::: :::
ATGGGTAATACGAGCAGTGAGCGCGCTGCGCTGGACCGGCAAGGGGGTCACAAGACTCCCCGAAGGGACAGTTCGGGGGGCTCCAAGGATGGGGACCGGC
-M--G--N--T--S--S--E--R--A--A--L--D--R--Q--G--G--H--K--T--P--R--R--D--S--S--G--G--S--K--D--G--D--R--

----------------------------------------------------------><----------------------------------------
P--K--I--L--M--D--S--P--E--D--A--D--L--F--H--S--E--E--I--K--A--P--E--K--E--E--F--L--A--W--Q--H--D--L
CCAAGATCCTGATGGACAGCCCCGAAGACGCCGACCTCTTCCACTCCGAGGAAATCAAGGCACCAGAGAAGGAGGAATTCCTGGCCTGGCAGCATGATCT
::::.:::.:::::::::::::.::.:::::.::::::: :::::::::::::::.::::: ::::::::::::::.:::::::::::::::::::::::
CCAAAATCTTGATGGACAGCCCTGAGGACGCTGACCTCTACCACTCCGAGGAAATTAAGGCTCCAGAGAAGGAGGAGTTCCTGGCCTGGCAGCATGATCT
P--K--I--L--M--D--S--P--E--D--A--D--L--Y--H--S--E--E--I--K--A--P--E--K--E--E--F--L--A--W--Q--H--D--L

----------------------------------------------------------------------------------------------------
--E--V--N--D--K--A--P--A--Q--A--R--P--T--V--F--R--W--T--G--G--G--K--E--V--Y--L--S--G--S--F--N--N--W-
GGAAGTGAATGATAAAGCTCCCGCCCAGGCTCGGCCAACGGTGTTTCGATGGACGGGGGGCGGAAAGGAAGTTTACTTATCTGGGTCCTTCAACAACTGG
:::.:: :::::::::::..:.::::::::::::::::: ::::::::::::::::::::.::::::::::::::::::::.:: :::::::::::::::
GGAGGTTAATGATAAAGCCTCTGCCCAGGCTCGGCCAACTGTGTTTCGATGGACGGGGGGTGGAAAGGAAGTTTACTTATCCGGCTCCTTCAACAACTGG
--E--V--N--D--K--A--S--A--Q--A--R--P--T--V--F--R--W--T--G--G--G--K--E--V--Y--L--S--G--S--F--N--N--W-

----------------------><----------------------------------------------------------------------------
-S--K--L--P--L--T--R--S--H--N--N--F--V--A--I--L--D--L--P--E--G--E--H--Q--Y--K--F--F--V--D--G--Q--W--
AGTAAACTTCCCCTCACCAGAAGCCACAATAACTTTGTAGCCATCCTGGATCTGCCGGAAGGAGAGCATCAGTACAAGTTCTTTGTGGATGGTCAGTGGA
::.::::::::::::         ::::::::.::::: ::::::::::::::::: ::::::::::::::::::::.:::.::::::::::::::::::
AGCAAACTTCCCCTC---------CACAATAATTTTGTCGCCATCCTGGATCTGCCTGAAGGAGAGCATCAGTACAAATTCCTTGTGGATGGTCAGTGGA
-S--K--L--P--L-----------H--N--N--F--V--A--I--L--D--L--P--E--G--E--H--Q--Y--K--F--L--V--D--G--Q--W--

----------------><----------------------------------------------------------------------------------
T--H--D--P--S--E--P--I--V--T--S--Q--L--G--T--V--N--N--I--I--Q--V--K--K--T--D--F--E--V--F--D--A--L--M
CGCACGACCCTTCCGAGCCCATAGTAACCAGCCAGCTTGGCACAGTTAACAACATCATTCAAGTGAAGAAAACTGACTTTGAAGTATTTGATGCTTTAAT
:.::::::::.::.::::: .:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CACACGACCCCTCTGAGCCAGTAGTAACCAGCCAGCTTGGCACAGTTAACAACATCATTCAAGTGAAGAAAACTGACTTTGAAGTATTTGATGCTTTAAT
T--H--D--P--S--E--P--V--V--T--S--Q--L--G--T--V--N--N--I--I--Q--V--K--K--T--D--F--E--V--F--D--A--L--M

-------------------------------><-------------------------------------------------------------------
--V--D--S--Q--K--C--S--D--V--S--E--L--S--S--S--P--P--G--P--Y--H--Q--E--P--Y--V--C--K--P--E--E--R--F-
GGTGGATTCCCAAAAGTGCTCCGATGTGTCTGAGCTGTCCAGTTCTCCCCCAGGACCCTACCATCAGGAGCCCTACGTCTGCAAACCCGAAGAGCGCTTT
:::::::::::::::::::::::::::.:::   :::::::::::.:: :::::::::::::::::::::::::::::::: ::::: ::.::::: :::
GGTGGATTCCCAAAAGTGCTCCGATGTATCT---CTGTCCAGTTCCCCGCCAGGACCCTACCATCAGGAGCCCTACGTCTGGAAACCAGAGGAGCGGTTT
--V--D--S--Q--K--C--S--D--V--S-----L--S--S--S--P--P--G--P--Y--H--Q--E--P--Y--V--W--K--P--E--E--R--F-

-----------------------------------------------------------------><---------------------------------
-R--A--P--P--I--L--P--P--H--L--L--Q--V--I--L--N--K--D--T--G--I--S--C--D--P--A--L--L--P--E--P--N--H--
CGGGCACCCCCTATTCTCCCCCCACATCTCCTCCAGGTCATCCTGAACAAGGACACGGGGATTTCCTGTGATCCAGCTTTGCTTCCTGAGCCCAATCACG
 ..:: :: ::.::.::::: :::::.::.::::::::::::::::::::::::::.:: :::   :::::::::::::::::::::::::::::.::::
AAAGCCCCACCCATCCTCCCACCACACCTTCTCCAGGTCATCCTGAACAAGGACACAGGCATT---TGTGATCCAGCTTTGCTTCCTGAGCCCAACCACG
-K--A--P--P--I--L--P--P--H--L--L--Q--V--I--L--N--K--D--T--G--I-----C--D--P--A--L--L--P--E--P--N--H--

----------------------------------><----------------------------------------------------------------
V--M--L--N--H--L--Y--A--L--S--I--K--D--G--V--M--V--L--S--A--T--H--R--Y--K--K--K--Y--V--T--T--L--L--Y
TCATGCTGAACCACCTATACGCGCTGTCTATCAAGGATGGAGTGATGGTGCTCAGCGCAACCCACCGGTACAAGAAGAAGTACGTCACCACCTTGTTATA
:::::.:::::::::: :::::.::.::.:::::::::::::::::::::::::::::.:::::::::::::::::.::.::.:::::.::::::::.::
TCATGTTGAACCACCTTTACGCACTATCCATCAAGGATGGAGTGATGGTGCTCAGCGCGACCCACCGGTACAAGAAAAAATATGTCACTACCTTGTTGTA
V--M--L--N--H--L--Y--A--L--S--I--K--D--G--V--M--V--L--S--A--T--H--R--Y--K--K--K--Y--V--T--T--L--L--Y

------------>
--K--P--I--*-
CAAGCCCATATGA
:::::::::::::
CAAGCCCATATGA
--K--P--I--*-

Pig Consensus Sequence

>BGISUST0000880345
ATGGGTAATACGAGCAGTGAGCGCGCTGCGCTGGACCGGCAAGGGGGTCACAAGACTCCCCGAAGGGACAGTTCGGGGGGCTCCAAGGATGGGGACCGGC
CCAAAATCTTGATGGACAGCCCTGAGGACGCTGACCTCTACCACTCCGAGGAAATTAAGGCTCCAGAGAAGGAGGAGTTCCTGGCCTGGCAGCATGATCT
GGAGGTTAATGATAAAGCCTCTGCCCAGGCTCGGCCAACTGTGTTTCGATGGACGGGGGGTGGAAAGGAAGTTTACTTATCCGGCTCCTTCAACAACTGG
AGCAAACTTCCCCTC---------CACAATAATTTTGTCGCCATCCTGGATCTGCCTGAAGGAGAGCATCAGTACAAATTCCTTGTGGATGGTCAGTGGA
CACACGACCCCTCTGAGCCAGTAGTAACCAGCCAGCTTGGCACAGTTAACAACATCATTCAAGTGAAGAAAACTGACTTTGAAGTATTTGATGCTTTAAT
GGTGGATTCCCAAAAGTGCTCCGATGTATCT---CTGTCCAGTTCCCCGCCAGGACCCTACCATCAGGAGCCCTACGTCTGGAAACCAGAGGAGCGGTTT
AAAGCCCCACCCATCCTCCCACCACACCTTCTCCAGGTCATCCTGAACAAGGACACAGGCATT---TGTGATCCAGCTTTGCTTCCTGAGCCCAACCACG
TCATGTTGAACCACCTTTACGCACTATCCATCAAGGATGGAGTGATGGTGCTCAGCGCGACCCACCGGTACAAGAAAAAATATGTCACTACCTTGTTGTA
CAAGCCCATATGA


>BGISUSP0000880345
MGNTSSERAALDRQGGHKTPRRDSSGGSKDGDRPKILMDSPEDADLYHSEEIKAPEKEEFLAWQHDLEVNDKASAQARPTVFRWTGGGKEVYLSGSFNNW
SKLPL---HNNFVAILDLPEGEHQYKFLVDGQWTHDPSEPVVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVS-LSSSPPGPYHQEPYVWKPEERF
KAPPILPPHLLQVILNKDTGI-CDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI*