Sequences
EST Library Info
med1Mediastinum
Clusters
Oligos
SNPs

Gene ID ENSG00000111956 (click for geneview)
Transcript ID ENST00000229681(link to ensembl)
Symbol TNF
Localtion Chromosome:6:31651329:31654082:1 band: 6p21.33
Description Tumor necrosis factor precursor (TNF-alpha) (Tumor necrosis factor ligand superfamily member 2) (TNF-a) (Cachectin). [Source:Uniprot/SWISSPROT;Acc:P01375]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--S--T--E--S--M--I--R--D--V--E--L--A--E--E--A--L--P--K--K--T--G--G--P--Q--G--S--R--R--C--L--F--L--
ATGAGCACTGAAAGCATGATCCGGGACGTGGAGCTGGCCGAGGAGGCGCTCCCCAAGAAGACAGGGGGGCCCCAGGGCTCCAGGCGGTGCTTGTTCCTCA
:::::::::::.:::::::::::.:::::::::::::: :::::::::::: ::::::::.: ::::: ::::::::::::::: :::::.::: :::::
ATGAGCACTGAGAGCATGATCCGAGACGTGGAGCTGGCGGAGGAGGCGCTCGCCAAGAAGGCCGGGGGCCCCCAGGGCTCCAGGAGGTGCCTGTGCCTCA
-M--S--T--E--S--M--I--R--D--V--E--L--A--E--E--A--L--A--K--K--A--G--G--P--Q--G--S--R--R--C--L--C--L--

-------------------------------------------------------------------------------------><-------------
S--L--F--S--F--L--I--V--A--G--A--T--T--L--F--C--L--L--H--F--G--V--I--G--P--Q--R--E--E--F--P--R--D--L
GCCTCTTCTCCTTCCTGATCGTGGCAGGCGCCACCACGCTCTTCTGCCTGCTGCACTTTGGAGTGATCGGCCCCCAGAGGGAAGAGTTCCCCAGGGACCT
::::::::::::::::  : :: ::::: ::::::::::::::::::::.::::::::.:..:: :::::::::::::.:::::::              
GCCTCTTCTCCTTCCTCCTGGTCGCAGGAGCCACCACGCTCTTCTGCCTACTGCACTTCGAGGTTATCGGCCCCCAGAAGGAAGAG--------------
S--L--F--S--F--L--L--V--A--G--A--T--T--L--F--C--L--L--H--F--E--V--I--G--P--Q--K--E--E---------------

-------------------------------><----------------------------------------------><-------------------
--S--L--I--S--P--L--A--Q--A--V--R--S--S--S--R--T--P--S--D--K--P--V--A--H--V--V--A--N--P--Q--A--E--G-
CTCTCTAATCAGCCCTCTGGCCCAGGCAGTCAGATCATCTTCTCGAACCCCGAGTGACAAGCCTGTAGCCCATGTTGTAGCAAACCCTCAAGCTGAGGGG
                                                                                           ::.:::::.
-------------------------------------------------------------------------------------------GCCGAGGGA
--------------------------------------------------------------------------------------------A--E--G-

----------------------------------------------------------------------------------------------------
-Q--L--Q--W--L--N--R--R--A--N--A--L--L--A--N--G--V--E--L--R--D--N--Q--L--V--V--P--S--E--G--L--Y--L--
CAGCTCCAGTGGCTGAACCGCCGGGCCAATGCCCTCCTGGCCAATGGCGTGGAGCTGAGAGATAACCAGCTGGTGGTGCCATCAGAGGGCCTGTACCTCA
::::::::.:::: ::.. : .. ::::::::::::::::::::.::::::.::::::.:::.:::::::::::::::::. :::: :: ::::::::::
CAGCTCCAATGGCAGAGTGGGTATGCCAATGCCCTCCTGGCCAACGGCGTGAAGCTGAAAGACAACCAGCTGGTGGTGCCGACAGATGGGCTGTACCTCA
-Q--L--Q--W--Q--S--G--Y--A--N--A--L--L--A--N--G--V--K--L--K--D--N--Q--L--V--V--P--T--D--G--L--Y--L--

----------------------------------------------------------------------------------------------------
I--Y--S--Q--V--L--F--K--G--Q--G--C--P--S--T--H--V--L--L--T--H--T--I--S--R--I--A--V--S--Y--Q--T--K--V
TCTACTCCCAGGTCCTCTTCAAGGGCCAAGGCTGCCCCTCCACCCATGTGCTCCTCACCCACACCATCAGCCGCATCGCCGTCTCCTACCAGACCAAGGT
:::::::::::::::::::::.:::::::::::::::.:::::: :.:: .:::::::.:::::::::::::::::::::::::::::::::::::::::
TCTACTCCCAGGTCCTCTTCAGGGGCCAAGGCTGCCCTTCCACCAACGTTTTCCTCACTCACACCATCAGCCGCATCGCCGTCTCCTACCAGACCAAGGT
I--Y--S--Q--V--L--F--R--G--Q--G--C--P--S--T--N--V--F--L--T--H--T--I--S--R--I--A--V--S--Y--Q--T--K--V

----------------------------------------------------------------------------------------------------
--N--L--L--S--A--I--K--S--P--C--Q--R--E--T--P--E--G--A--E--A--K--P--W--Y--E--P--I--Y--L--G--G--V--F-
CAACCTCCTCTCTGCCATCAAGAGCCCCTGCCAGAGGGAGACCCCAGAGGGGGCTGAGGCCAAGCCCTGGTATGAGCCCATCTATCTGGGAGGGGTCTTC
:::::::::::::::::::::::::::.::::::::::::::::: ::::::::.:::::::::::::::::.::.::::::::.:::::::::::::::
CAACCTCCTCTCTGCCATCAAGAGCCCTTGCCAGAGGGAGACCCCCGAGGGGGCCGAGGCCAAGCCCTGGTACGAACCCATCTACCTGGGAGGGGTCTTC
--N--L--L--S--A--I--K--S--P--C--Q--R--E--T--P--E--G--A--E--A--K--P--W--Y--E--P--I--Y--L--G--G--V--F-

----------------------------------------------------------------------------------------------------
-Q--L--E--K--G--D--R--L--S--A--E--I--N--R--P--D--Y--L--D--F--A--E--S--G--Q--V--Y--F--G--I--I--A--L--
CAGCTGGAGAAGGGTGACCGACTCAGCGCTGAGATCAATCGGCCCGACTATCTCGACTTTGCCGAGTCTGGGCAGGTCTACTTTGGGATCATTGCCCTGT
:::::::::::::.:::.::::::::.::.::::::::..: ::::::::::: ::::::::.::.::::::::::::::.:::::::::::::::    
CAGCTGGAGAAGGATGATCGACTCAGTGCCGAGATCAACTG-CCCGACTATCTGGACTTTGCTGAATCTGGGCAGGTCTATTTTGGGATCATTGCC----
-Q--L--E--K--D--D--R--L--S--A--E--I--N--*--P--D--Y--L--D--F--A--E--S--G--Q--V--Y--F--G--I--I--A-----

--
*-
GA
  
--
--

Pig Consensus Sequence

>BGISUST0000894077
ATGAGCACTGAGAGCATGATCCGAGACGTGGAGCTGGCGGAGGAGGCGCTCGCCAAGAAGGCCGGGGGCCCCCAGGGCTCCAGGAGGTGCCTGTGCCTCA
GCCTCTTCTCCTTCCTCCTGGTCGCAGGAGCCACCACGCTCTTCTGCCTACTGCACTTCGAGGTTATCGGCCCCCAGAAGGAAGAG--------------
-------------------------------------------------------------------------------------------GCCGAGGGA
CAGCTCCAATGGCAGAGTGGGTATGCCAATGCCCTCCTGGCCAACGGCGTGAAGCTGAAAGACAACCAGCTGGTGGTGCCGACAGATGGGCTGTACCTCA
TCTACTCCCAGGTCCTCTTCAGGGGCCAAGGCTGCCCTTCCACCAACGTTTTCCTCACTCACACCATCAGCCGCATCGCCGTCTCCTACCAGACCAAGGT
CAACCTCCTCTCTGCCATCAAGAGCCCTTGCCAGAGGGAGACCCCCGAGGGGGCCGAGGCCAAGCCCTGGTACGAACCCATCTACCTGGGAGGGGTCTTC
CAGCTGGAGAAGGATGATCGACTCAGTGCCGAGATCAAccCCGACTATCTGGACTTTGCTGAATCTGGGCAGGTCTATTTTGGGATCATTGCC------


>BGISUSP0000894077
MSTESMIRDVELAEEALAKKAGGPQGSRRCLCLSLFSFLLVAGATTLFCLLHFEVIGPQKEE-----------------------------------AEG
QLQWQSGYANALLANGVKLKDNQLVVPTDGLYLIYSQVLFRGQGCPSTNVFLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVF
QLEKDDRLSAEINPDYLDFAESGQVYFGIIA--