Sequences
EST Library Info
ecc4Foetus 50 days, cortex cerebri
eep1Foetus 50 days, epidermis
eje4Foetus 50 days, jejunum
ese2Foetus 50 days, M. semitendinosus
eye1Foetus 50 days, Eye
fhi1Unavailable
hyp3Hypothalamus
jca1Joint capsule
lnt1Lymphatic nodule tracheobroncalis
mcp3Mammae, collostrum producing
med2Mediastinum
nep1Newborn 115 days, epidermis
nlu4Newborn 115 days, lung
ute2Uterus
Clusters
Oligos
SNPs

Gene ID ENSG00000111960 (click for geneview)
Transcript ID ENST00000229685(link to ensembl)
Symbol BAT2
Localtion Chromosome:6:31696576:31713516:1 band: 6p21.33
Description Large proline-rich protein BAT2 (HLA-B-associated transcript 2) (G2). [Source:Uniprot/SWISSPROT;Acc:P48634]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--S--D--R--S--G--P--T--A--K--G--K--D--G--K--K--Y--S--S--L--N--L--F--D--T--Y--K--G--K--S--L--E--I--
ATGTCCGATCGCTCGGGGCCGACTGCCAAGGGAAAGGATGGAAAGAAGTATTCCTCGCTCAACCTGTTTGATACGTATAAGGGCAAGTCCTTAGAGATCC
::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
ATGTCCGATCGCTCGGGGCCGACTGCCAAGGGGAAGGATGGAAAGAAGTATTCCTCGCTCAACCTGTTTGATACGTATAAGGGCAAGTCCTTAGAGATCC
-M--S--D--R--S--G--P--T--A--K--G--K--D--G--K--K--Y--S--S--L--N--L--F--D--T--Y--K--G--K--S--L--E--I--

-----------><--><-----------------------------------------------------><----------------------------
Q--K--P--A--E--N--C--P--S--P--W--P--A--E--S--R--E--S--C--H--C--P--A--Y--P--P--A--N--L--P--S--L--K--A
AGAAACCCGCTGAGAATTGCCCCTCGCCATGGCCTGCAGAGTCTCGGGAAAGTTGCCATTGCCCGGCGTATCCTCCAGCCAACCTTCCAAGCCTGAAAGC
:::::::::::      :::::::::::::::::::::::::::::::::::::::.:::::.::::::::::.::::::::::::::::::::::::::
AGAAACCCGCT------TGCCCCTCGCCATGGCCTGCAGAGTCTCGGGAAAGTTGCTATTGCTCGGCGTATCCCCCAGCCAACCTTCCAAGCCTGAAAGC
Q--K--P--A--------C--P--S--P--W--P--A--E--S--R--E--S--C--Y--C--S--A--Y--P--P--A--N--L--P--S--L--K--A

-----------------------------------------------------------------------------------------><---------
--E--N--K--G--N--D--P--N--V--S--L--V--P--K--D--G--T--G--W--A--S--K--Q--E--Q--S--D--P--K--S--S--D--A-
CGAGAACAAAGGCAATGACCCCAATGTCTCACTAGTGCCAAAAGACGGAACAGGATGGGCAAGCAAACAGGAGCAGTCCGACCCCAAGAGTTCCGATGCC
::::::::::::::::::::::::.::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::   :::::::::
CGAGAACAAAGGCAATGACCCCAACGTCTCACTAGTGCCGAAAGACGGAACAGGATGGGCAAGCAAACAGGAGCAGTCCGACCCCAAG---TCCGATGCC
--E--N--K--G--N--D--P--N--V--S--L--V--P--K--D--G--T--G--W--A--S--K--Q--E--Q--S--D--P--K-----S--D--A-

-----------------------------------------------------------------------------------------><---------
-S--T--A--Q--P--P--E--S--Q--P--L--P--A--S--Q--T--P--A--S--N--Q--P--K--R--P--P--A--A--P--E--N--T--P--
TCAACCGCTCAGCCGCCGGAATCGCAGCCACTGCCGGCTTCACAGACGCCTGCCTCCAACCAGCCGAAACGACCCCCAGCAGCCCCCGAGAACACTCCTT
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::: :::::::::::::
TCAACCGCTCAGCCGCCGGAATCGCAGCCACTGCCGGCTTCACAGACGCCTGCCTCCAACCAACCGAAACGACCCCCAGCAGCCCCAGAGAACACTCCTT
-S--T--A--Q--P--P--E--S--Q--P--L--P--A--S--Q--T--P--A--S--N--Q--P--K--R--P--P--A--A--P--E--N--T--P--

--------------------------------------------------------------><------------------------------------
L--V--P--S--G--V--K--S--W--A--Q--A--S--V--T--H--G--A--H--G--D--G--G--R--A--S--S--L--L--S--R--F--S--R
TGGTTCCAAGCGGGGTAAAGTCCTGGGCACAAGCCAGCGTCACCCATGGAGCACATGGAGATGGTGGAAGGGCATCAAGCCTACTGTCACGATTCTCTCG
.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::   :::::::::::::::::::::::::::::::::::
CGGTTCCAAGCGGGGTAAAGTCCTGGGCACAAGCCAGCGTCACCCATGGAGCACATGGAGAT---GGAAGGGCATCAAGCCTACTGTCACGATTCTCTCG
S--V--P--S--G--V--K--S--W--A--Q--A--S--V--T--H--G--A--H--G--D-----G--R--A--S--S--L--L--S--R--F--S--R

----------------------------------------------------------------------------------------------------
--E--E--F--P--T--L--Q--A--A--G--D--Q--D--K--A--A--K--E--R--E--S--A--E--Q--S--S--G--P--G--P--S--L--R-
AGAGGAATTTCCGACCCTGCAGGCGGCTGGCGACCAGGACAAGGCTGCCAAGGAAAGGGAGTCTGCCGAACAGTCGTCTGGGCCCGGACCAAGCCTCCGC
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
AGAGGAATTTCCGACCCTGCAGGCGGCTGGCGACCAGGACAAGGCTGCCAAGGAAAGGGAGTCTGCCGAACAGTCGTCTGGGCCCGGACCAAGCCTCCGC
--E--E--F--P--T--L--Q--A--A--G--D--Q--D--K--A--A--K--E--R--E--S--A--E--Q--S--S--G--P--G--P--S--L--R-

------><--------------------------------------------------------------------------------------------
-P--Q--N--S--T--T--W--R--D--G--G--G--R--G--P--D--E--L--E--G--P--D--S--K--L--H--H--G--H--D--P--R--G--
CCCCAAAATTCTACAACTTGGAGGGACGGAGGTGGGCGTGGCCCTGATGAGCTGGAGGGCCCGGACTCCAAACTTCATCATGGTCATGATCCCCGGGGTG
::::::   ::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::.::::::::::::::::
CCCCAA---TCCACAACTTGGAGGGACGGAGGTGGGCGTGGCCCTGATGAGCTGGAGGGCCCGGACTCCAAACTTCATCACGGCCATGATCCCCGGGGTG
-P--Q-----S--T--T--W--R--D--G--G--G--R--G--P--D--E--L--E--G--P--D--S--K--L--H--H--G--H--D--P--R--G--

----------------------------------------------------------><----------------------------------------
G--L--Q--P--S--G--P--P--Q--F--P--P--Y--R--G--M--M--P--P--F--M--Y--P--P--Y--L--P--F--P--P--P--Y--G--P
GGCTACAGCCTTCAGGCCCACCCCAGTTCCCTCCCTACCGCGGAATGATGCCGCCTTTCATGTATCCCCCATATCTCCCGTTCCCTCCGCCCTATGGACC
::::.::::::::::::::::::::::::::::::::::::::::::::::::::.                                 :::::::::::
GGCTGCAGCCTTCAGGCCCACCCCAGTTCCCTCCCTACCGCGGAATGATGCCGCCC---------------------------------CCCTATGGACC
G--L--Q--P--S--G--P--P--Q--F--P--P--Y--R--G--M--M--P--P-----------------------------------P--Y--G--P

--------------------------------------><------------------------------------------------------------
--Q--G--P--Y--R--Y--P--T--P--D--G--P--S--R--F--P--R--V--A--G--P--R--G--S--G--P--P--M--R--L--V--E--P-
CCAGGGGCCTTACCGATACCCCACTCCTGATGGGCCCAGCCGTTTTCCCCGTGTGGCGGGCCCCCGAGGCTCAGGGCCACCAATGCGCTTAGTAGAGCCT
::::::::::::::::::::::.:::::::::::      :::::.:::::::::::.::::::::::::::::::::::::::::::.: :::::::::
CCAGGGGCCTTACCGATACCCCGCTCCTGATGGG------CGTTTCCCCCGTGTGGCAGGCCCCCGAGGCTCAGGGCCACCAATGCGCCTCGTAGAGCCT
--Q--G--P--Y--R--Y--P--A--P--D--G--------R--F--P--R--V--A--G--P--R--G--S--G--P--P--M--R--L--V--E--P-

---------------------------------------------------------------------------------><-----------------
-V--G--R--P--S--I--L--K--E--D--N--L--K--E--F--D--Q--L--D--Q--E--N--D--D--G--W--A--G--A--H--E--E--V--
GTGGGTCGTCCCTCTATTCTCAAAGAGGATAATCTCAAAGAGTTTGATCAGTTGGATCAGGAGAATGATGATGGTTGGGCAGGGGCCCATGAAGAGGTTG
:::::::: ::.::.:::::.:::::.::::::::::::::::::::.::::::::.::::::::::::::::::::::::   ::::::::.:::::.:
GTGGGTCGGCCTTCCATTCTTAAAGAAGATAATCTCAAAGAGTTTGACCAGTTGGACCAGGAGAATGATGATGGTTGGGCA---GCCCATGAGGAGGTCG
-V--G--R--P--S--I--L--K--E--D--N--L--K--E--F--D--Q--L--D--Q--E--N--D--D--G--W--A-----A--H--E--E--V--

------------------------------------------------------------------------><--------------------------
D--Y--T--E--K--L--K--F--S--D--E--E--D--G--R--D--S--D--E--E--G--A--E--G--H--R--D--S--Q--S--A--S--G--E
ACTACACTGAAAAGCTCAAGTTCAGCGATGAGGAAGATGGGCGAGACTCTGATGAGGAGGGTGCTGAGGGCCACAGGGATTCCCAATCAGCTTCTGGTGA
::::::::::.::::::::::::::::::::::::::.::::::::::::::::::::::: :::::::::   :.::: :::::. :::::  .:::::
ACTACACTGAGAAGCTCAAGTTCAGCGATGAGGAAGACGGGCGAGACTCTGATGAGGAGGGAGCTGAGGGC---AAGGAGTCCCAGGCAGCTGGCGGTGA
D--Y--T--E--K--L--K--F--S--D--E--E--D--G--R--D--S--D--E--E--G--A--E--G-----K--E--S--Q--A--A--G--G--E

----------------------------------------------------------------------------------------------------
--E--R--P--P--E--A--D--G--K--K--G--N--S--P--N--S--E--P--P--T--P--K--T--A--W--A--E--T--S--R--P--P--E-
GGAACGGCCCCCTGAAGCAGATGGCAAAAAGGGCAACTCCCCCAACAGCGAACCGCCCACTCCTAAGACGGCCTGGGCAGAAACCTCTCGGCCTCCAGAG
:::::::::::::::::::::::::::::::::::::::::::..::::::::::::: ::::.:::::::::::::::::.::::::::::::::::::
GGAACGGCCCCCTGAAGCAGATGGCAAAAAGGGCAACTCCCCCGGCAGCGAACCGCCCCCTCCCAAGACGGCCTGGGCAGAGACCTCTCGGCCTCCAGAG
--E--R--P--P--E--A--D--G--K--K--G--N--S--P--G--S--E--P--P--P--P--K--T--A--W--A--E--T--S--R--P--P--E-

-----------------------------------------------------------------------------------------><---------
-T--E--P--G--P--P--A--P--K--P--P--L--P--P--P--H--R--G--P--A--G--N--W--G--P--P--G--D--Y--P--D--R--G--
ACAGAGCCGGGACCTCCTGCCCCAAAGCCTCCCCTACCCCCACCTCACCGGGGCCCCGCCGGGAACTGGGGCCCCCCTGGGGACTACCCAGATCGTGGGG
:::::::::::.::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: ::::
ACAGAGCCGGGGCCTCCTGCCCCAAAGCCTCCCCCACCCCCACCTCACCGGGGCCCCGCCGGGAACTGGGGCCCCCCTGGGGACTACCCAGATCGAGGGG
-T--E--P--G--P--P--A--P--K--P--P--P--P--P--P--H--R--G--P--A--G--N--W--G--P--P--G--D--Y--P--D--R--G--

----------------------------------------------------------------------------------------------------
G--P--P--C--K-----P--P--A--P--E--D--E--D--E--A--W--R--Q--R--R--K--Q--S--S--S--E--I--S--L--A--V--E--R
GTCCTCCCTGCAAG---CCCCCAGCACCTGAAGATGAGGATGAGGCATGGCGGCAGCGACGAAAGCAGTCGTCATCTGAGATTTCCCTGGCAGTGGAGCG
:.::::::::::.:    ::::::::::::::::.:::::::::::::::::.:::::.::.:::::::: :::::::::::.:::::::: ::::::::
GCCCTCCCTGCAGGC--GCCCCAGCACCTGAAGACGAGGATGAGGCATGGCGACAGCGGCGGAAGCAGTCTTCATCTGAGATCTCCCTGGCTGTGGAGCG
G--P--P--C--R--\--P--P--A--P--E--D--E--D--E--A--W--R--Q--R--R--K--Q--S--S--S--E--I--S--L--A--V--E--R

----------------------------------------------------------------------------------------------------
--A--R--R--R--R--E--E--E--E--R--R--M--Q--E--E--R--R--A--A--C--A--E--K--L--K--R--L--D--E--K--F--G--A-
GGCCCGGCGACGGCGAGAAGAAGAGGAGCGGCGCATGCAAGAAGAGCGCCGGGCAGCCTGTGCTGAGAAGCTCAAGCGACTCGATGAAAAGTTTGGGGCA
:::::::::.::::::::.::.::::::::.:::::::::::.:::::: :::: ::::::::.:::::::::::::::::.:::::.::::::::::::
GGCCCGGCGGCGGCGAGAGGAGGAGGAGCGACGCATGCAAGAGGAGCGCAGGGCTGCCTGTGCCGAGAAGCTCAAGCGACTTGATGAGAAGTTTGGGGCA
--A--R--R--R--R--E--E--E--E--R--R--M--Q--E--E--R--R--A--A--C--A--E--K--L--K--R--L--D--E--K--F--G--A-

----------------------------------------------------------------------------------------------------
-P--D--K--R--L--K--A--E--P--A--A--P--P--A--A--P--S--T--P--A--P--P--P--A--V--P--K--E--L--P--A--P--P--
CCTGACAAGCGGCTCAAAGCAGAGCCTGCTGCCCCACCTGCTGCCCCTTCTACCCCAGCTCCACCACCTGCAGTCCCTAAAGAACTCCCTGCACCTCCAG
::.::::::::::::::.::::::::::: :: :::::.::::.::::.::.:::: ::::::::::::::::::::.:::::::::::..:::::::::
CCCGACAAGCGGCTCAAGGCAGAGCCTGCGGCACCACCCGCTGTCCCTCCTGCCCCCGCTCCACCACCTGCAGTCCCCAAAGAACTCCCCACACCTCCAG
-P--D--K--R--L--K--A--E--P--A--A--P--P--A--V--P--P--A--P--A--P--P--P--A--V--P--K--E--L--P--T--P--P--

----------------------------------------------------------------------------------------------------
A--P--P--P--A--S--A--P--T--P--E--T--E--P--E--E--P--A--Q--A--P--P--A--Q--S--T--P--T--P--G--V--A--A--A
CTCCACCTCCAGCATCAGCCCCAACACCAGAGACAGAACCTGAAGAGCCAGCACAGGCCCCTCCTGCCCAATCTACTCCTACTCCAGGTGTGGCTGCGGC
: :: .: ::.:::.:::.::::::::: ::.: :::::: ::::::::.::::::::::::::::::::.::.::.::.::::::::::::::: :.::
CACCTTCACCGGCACCAGTCCCAACACCTGAAAAAGAACCAGAAGAGCCGGCACAGGCCCCTCCTGCCCAGTCCACCCCCACTCCAGGTGTGGCTCCAGC
A--P--S--P--A--P--V--P--T--P--E--K--E--P--E--E--P--A--Q--A--P--P--A--Q--S--T--P--T--P--G--V--A--P--A

-------------------------------------------------------------------><-------------------------------
--P--T--L--V--S--G--G--G--S--T--S--S--T--S--S--G--S--F--E--A--S--P--V--E--P--Q--L--P--S--K--E--G--P-
TCCCACTCTGGTGAGTGGTGGTGGCAGTACCAGTAGCACCAGCAGTGGCAGCTTCGAAGCCAGCCCAGTGGAACCACAACTGCCCTCAAAAGAGGGTCCT
::::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::   ::::: ::.:::::::::::::::::::::
TCCCACCCTGGTGAGTGGTGGTGGCAGTACCAGTAGCACCAGCAGTGGCAGCTTCGAAGCCAGCCCA---GAACCCCAGCTGCCCTCAAAAGAGGGTCCT
--P--T--L--V--S--G--G--G--S--T--S--S--T--S--S--G--S--F--E--A--S--P-----E--P--Q--L--P--S--K--E--G--P-

----------------------------------------------------------------------------------------------------
-E--P--P--E--E--V--P--P--P--T--T--P--P--V--P--K--V--E--P--K--G--D--G--I--G--P--T--R--Q--P--P--S--Q--
GAACCACCAGAAGAGGTTCCTCCTCCTACCACACCCCCAGTTCCAAAGGTGGAACCCAAGGGTGATGGGATTGGTCCCACCCGCCAGCCCCCTAGTCAGG
:::.::::::::::::::::: : :::.::::::: ::::. :::::::::::::::::::::::::::::::::::.::::: ::::::::.::.::.:
GAATCACCAGAAGAGGTTCCTGCACCTGCCACACCGCCAGCACCAAAGGTGGAACCCAAGGGTGATGGGATTGGTCCTACCCGGCAGCCCCCCAGCCAAG
-E--S--P--E--E--V--P--A--P--A--T--P--P--A--P--K--V--E--P--K--G--D--G--I--G--P--T--R--Q--P--P--S--Q--

----------------------------------------------------------><----------------------------------------
G--L--G--Y--P--K--Y--Q--K--S--L--P--P--R--F--Q--R--Q--Q--Q--E--Q--L--L--K--Q--Q--Q--Q--H--Q--W--Q--Q
GCTTGGGCTACCCCAAATATCAGAAGTCGTTGCCTCCTCGTTTCCAGCGGCAGCAGCAGGAGCAGCTCCTGAAGCAGCAGCAGCAGCACCAGTGGCAGCA
::::.::::::::.::::::::::::::.::::: :::::::::::::::::.:::::::::::::::.:.::::::::.::.::::: :::::::::::
GCTTAGGCTACCCTAAATATCAGAAGTCATTGCCGCCTCGTTTCCAGCGGCAACAGCAGGAGCAGCTCTTAAAGCAGCAACAACAGCAGCAGTGGCAGCA
G--L--G--Y--P--K--Y--Q--K--S--L--P--P--R--F--Q--R--Q--Q--Q--E--Q--L--L--K--Q--Q--Q--Q--Q--Q--W--Q--Q

----------------------------------------------------------------------------------------------------
--H--Q--Q--G--S--A--P--P--T--P--V--P--P--S--P--P--Q--P--V--T--L--G--A--V--P--A--P--Q--A--P--P--P--P-
GCATCAACAGGGCTCTGCCCCTCCTACCCCAGTGCCCCCATCACCACCACAGCCTGTGACCCTGGGGGCTGTGCCAGCTCCACAGGCTCCACCCCCGCCC
::::::::::::::::::::: :::.:::::::.:::::.::::::::::::::::::::. :::::::::::::.:::::::::::: : :: ::.:::
GCATCAACAGGGCTCTGCCCCACCTGCCCCAGTACCCCCGTCACCACCACAGCCTGTGACTATGGGGGCTGTGCCGGCTCCACAGGCTGCTCCACCACCC
--H--Q--Q--G--S--A--P--P--A--P--V--P--P--S--P--P--Q--P--V--T--M--G--A--V--P--A--P--Q--A--A--P--P--P-

----------------------------------------------------------------------------------------------------
-P--K--A--L--Y--P--G--A--L--G--R--P--P--P--M--P--P--M--N--F--D--P--R--W--M--M--I--P--P--Y--V--D--P--
CCCAAGGCCCTGTACCCAGGTGCTCTGGGCCGGCCCCCACCCATGCCCCCAATGAACTTTGATCCCCGATGGATGATGATTCCTCCTTATGTGGACCCCC
:: ::::::                                                                                           
CCAAAGGCC-------------------------------------------------------------------------------------------
-P--K--A--------------------------------------------------------------------------------------------

--------------------------------------------------------><------------------------------------------
R--L--L--Q--G--R--P--P--L--D--F--Y--P--P--G--V--H--P--S--G--L--V--P--R--E--R--S--D--S--G--G--S--S--S
GGCTCCTCCAGGGTCGTCCCCCTCTAGACTTCTACCCTCCTGGTGTGCATCCCTCTGGCCTAGTTCCCCGAGAGCGTTCAGACAGTGGGGGCTCAAGCTC
                                                           :::::::::::.:::::.:::::::::::.::::::::.::
-----------------------------------------------------------CTAGTTCCCCGGGAGCGCTCAGACAGTGGAGGCTCAAGTTC
------------------------------------------------------------L--V--P--R--E--R--S--D--S--G--G--S--S--S

----------------------------------------------------------------------------------------------------
--E--P--F--D--R--H--A--P--A--M--L--R--E--R--G--T--P--P--V--D--P--K--L--A--W--V--G--D--V--F--T--A--T-
AGAGCCATTTGACCGTCATGCACCTGCTATGTTACGGGAACGGGGCACTCCACCGGTGGATCCAAAGTTGGCCTGGGTAGGAGATGTCTTCACCGCCACA
:::::::::::: ::.:::::: :. :. : :::::.:: ::::::::.:::::.:::::::::::::::::::::::::::::::::::::::.:::::
AGAGCCATTTGAGCGCCATGCAGCCCCCCTCTTACGAGATCGGGGCACCCCACCAGTGGATCCAAAGTTGGCCTGGGTAGGAGATGTCTTCACCACCACA
--E--P--F--E--R--H--A--A--P--L--L--R--D--R--G--T--P--P--V--D--P--K--L--A--W--V--G--D--V--F--T--T--T-

-------------------------------------------------------------------><-------------------------------
-P--A--E--P--R--P--L--T--S--P--L--R--Q--A--A--D--E--D--D--K--G--M--R--S--E--T--P--P--V--P--P--P--P--
CCCGCTGAACCCCGCCCACTTACCTCACCTCTGCGCCAGGCTGCGGATGAGGATGACAAGGGGATGAGGAGCGAGACTCCTCCAGTACCTCCCCCACCAC
 ::.:::: .::::::: ::::::::::: ::::::::::::.: ::.::::: ::::::::::::   ::::::::.:::::::::   ::::::::.:
GCCACTGACTCCCGCCCCCTTACCTCACCACTGCGCCAGGCTACCGACGAGGAGGACAAGGGGATG---AGCGAGACCCCTCCAGTA---CCCCCACCGC
-A--T--D--S--R--P--L--T--S--P--L--R--Q--A--T--D--E--E--D--K--G--M-----S--E--T--P--P--V-----P--P--P--

----------------------------------------------------------------------------------------------------
P--Y--L--A--S--Y--P--G--F--P--E--N--G--A--P--G--P--P--I--S--R--F--P--L--E--E--P--G--P--R--P--L--P--W
CCTATCTGGCCAGTTATCCAGGCTTTCCTGAGAATGGAGCCCCTGGGCCCCCAATCTCTCGCTTTCCTCTGGAGGAACCAGGGCCCCGTCCACTCCCCTG
::::::::::::::::::::::::::::.::.::::::::::::::.:::::.::..:::::::.:::::::::                          
CCTATCTGGCCAGTTATCCAGGCTTTCCCGAAAATGGAGCCCCTGGACCCCCGATTCCTCGCTTCCCTCTGGAG--------------------------
P--Y--L--A--S--Y--P--G--F--P--E--N--G--A--P--G--P--P--I--P--R--F--P--L--E---------------------------

----------------------------------------------------------------------------------------------------
--P--P--G--S--D--E--V--A--K--I--Q--T--P--P--P--K--K--E--P--P--K--E--E--T--A--Q--L--T--G--P--E--A--G-
GCCCCCAGGCAGTGATGAAGTGGCCAAGATACAAACTCCACCACCCAAGAAGGAGCCCCCTAAGGAGGAGACTGCACAGCTGACGGGGCCAGAAGCAGGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-R--K--P--A--R--G--V--G--S--G--G--Q--G--P--P--P--P--R--R--E--S--R--T--E--T--R--W--G--P--R--P--G--S--
CGAAAGCCTGCCCGCGGAGTCGGGAGTGGAGGCCAGGGCCCCCCACCACCACGCAGAGAGAGTCGCACAGAGACCCGCTGGGGCCCTCGTCCAGGGAGCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
S--R--R--G--I--P--P--E--E--P--G--A--P--P--R--R--A--G--P--I--K--K--P--P--P--P--T--K--V--E--E--L--P--P
GTCGTCGTGGAATCCCTCCAGAGGAGCCAGGGGCCCCACCCCGCCGGGCTGGGCCTATAAAGAAACCTCCACCACCTACAAAAGTAGAAGAGCTGCCTCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--K--P--L--E--Q--G--D--E--T--P--K--P--P--K--P--D--P--L--K--I--T--K--G--K--L--G--G--P--K--E--T--P--P-
CAAGCCCCTCGAACAGGGGGATGAAACCCCCAAACCCCCAAAGCCAGACCCACTCAAGATAACCAAGGGGAAGCTAGGGGGCCCCAAGGAGACCCCACCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-N--G--N--L--S--P--A--P--R--L--R--R--D--Y--S--Y--E--R--V--G--P--T--S--C--R--G--R--G--R--G--E--Y--F--
AATGGAAATCTTTCCCCTGCCCCAAGGCTTCGGAGGGACTATTCGTATGAAAGAGTGGGTCCTACCTCTTGCCGGGGTCGGGGCCGAGGCGAGTATTTTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------><----------------------------------------------------
A--R--G--R--G--F--R--G--T--Y--G--G--R--G--R--G--E--A--G--N--S--A--V--T--E--S--F--E--E--M--M--G--V--E
CCAGAGGGAGGGGTTTTCGGGGGACCTATGGGGGACGAGGGCGGGGAGAAGCCGGGAATTCCGCAGTTACCGAGAGTTTCGAGGAGATGATGGGCGTGGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--V--G--Q--G--D--Q--T--T--L--L--L--P--E--A--A--L--P--A--R--H--G--A--R--V--Q--S--M--R--K--S--P--S--G-
GGTGGGACAGGGGGACCAAACCACCCTCCTGCTCCCCGAGGCCGCACTGCCAGCGAGACACGGAGCGAGGGTTCAGAGTATGAGGAAATCCCCAAGCGGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-A--G--S--G--A--Q--K--Q--A--A--R--P--M--R--V--I--W--L--L--Q--T--R--R--L--P--H--P--R--R--E--H--S--P--
GCCGGCAGCGGGGCTCAGAAACAGGCAGCGAGACCCATGAGAGTGATCTGGCTCCTTCAGACAAGGAGGCTCCCACACCCAAGGAGGGAACACTCACCCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----><----------------------------><-------------------><-------------------------------><----------
R--S--R--S--P--T--T--R--S--P--T--F--P--A--P--A--R--F--T--P--G--V--G--E--S--S--L--P--E--G--I--S--P--G
GGTCCCGCTCCCCCACCACCAGGAGCCCCACCTTCCCAGCCCCAGCCCGCTTCACTCCCGGGGTGGGCGAGTCTTCACTCCCAGAGGGGATCTCGCCGGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------><-----------------------------------------------------------------------------------
--P--R--R--R--E--P--P--Q--V--C--P--G--W--S--P--P--A--K--S--L--A--P--K--K--P--P--T--G--P--L--P--P--S-
GCCGAGGAGGAGGGAGCCTCCTCAAGTTTGCCCAGGCTGGAGCCCTCCAGCCAAGTCTCTGGCTCCCAAGAAACCTCCCACAGGCCCTTTGCCACCAAGT
                :::::.:  .:.:::::::::::::::::::::.:::::::.:::::::: :::::.::::: ::.::.:::::::::::::::
----------------CCTCCCCCCATCTGCCCAGGCTGGAGCCCTCCAACCAAGTCCCTGGCTCCGAAGAAGCCTCCAACGGGTCCTTTGCCACCAAGT
-----------------P--P--P--I--C--P--G--W--S--P--P--T--K--S--L--A--P--K--K--P--P--T--G--P--L--P--P--S-

----------------------------------------------------------------------------------------------------
-K--E--P--L--K--E--K--L--I--P--G--P--L--S--P--V--A--R--G--G--S--N--G--G--S--N--V--G--M--------E--D--
AAGGAGCCTTTGAAAGAGAAGTTGATCCCAGGGCCTCTGTCCCCTGTGGCGCGCGGAGGCAGCAATGGAGGTAGCAATGTGGGCATG------GAAGATG
:::::::::::::::::::::.:: :: :::::::::::::::::::::: :::::::::::::.::::::.::.::..::::: ::      :::::::
AAGGAGCCTTTGAAAGAGAAGCTGCTCACAGGGCCTCTGTCCCCTGTGGCCCGCGGAGGCAGCAGTGGAGGCAGTAACATGGGCCTGGGTGTGGAAGATG
-K--E--P--L--K--E--K--L--L--T--G--P--L--S--P--V--A--R--G--G--S--S--G--G--S--N--M--G--L--G--V--E--D--

----------------------------------------------------------------------------------------------------
G--E--R--P--R--R--R--R--H--G--R--A--Q--Q--Q--D--K--P--P--R--F--R--R--L--K--Q--E--R--E--N--A--A--R--G
GGGAGCGACCCCGAAGGAGGCGACATGGGAGGGCTCAGCAGCAGGATAAACCGCCTCGTTTCCGGAGGCTGAAGCAGGAACGGGAGAATGCCGCAAGGGG
:::::::.::: :::::::::::::.::::::::::::::::::::.:::::.:::::.::::::::::::::::::::::::::::::::.::.:::::
GGGAGCGGCCCAGAAGGAGGCGACACGGGAGGGCTCAGCAGCAGGACAAACCACCTCGCTTCCGGAGGCTGAAGCAGGAACGGGAGAATGCTGCGAGGGG
G--E--R--P--R--R--R--R--H--G--R--A--Q--Q--Q--D--K--P--P--R--F--R--R--L--K--Q--E--R--E--N--A--A--R--G

----------------------------------------------------------------------------------------------------
--S--E--G--K--P--S-----L--T--L--P--A--S--A--P--G--P--E--E--A--L--T--T--V--T--V--A--P--A--P--R--R--A-
GTCTGAGGGCAAGCCCTCC---CTAACCCTTCCAGCCTCCGCTCCTGGACCTGAGGAGGCCCTCACAACAGTCACAGTGGCCCCAGCACCTCGCCGGGCA
: :.::::::::::::::.   ::: :::: .::.:::: ::::: ::::: :::::::::::: : ::.:: .::::: ::::: :.::::::::::::
GGCCGAGGGCAAGCCCTCTTCCCTATCCCTGTCAACCTCGGCTCCGGGACCGGAGGAGGCCCTCCCCACGGTAGCAGTGCCCCCACCGCCTCGCCGGGCA
--A--E--G--K--P--S--S--L--S--L--S--T--S--A--P--G--P--E--E--A--L--P--T--V--A--V--P--P--P--P--R--R--A-

----------------------------------------------------------------------------------------------------
-A--A--K--S--P--D--L--S--N--Q--N--S--D--Q--A--N--E--E--W--E--T--A--S--E--S--S--D--F--T--S--E--R--R--
GCTGCCAAGTCTCCTGATCTGTCAAACCAGAACTCAGACCAAGCCAATGAGGAATGGGAGACTGCATCAGAGAGCAGTGACTTCACCAGTGAGCGCCGAG
::::::::::::::.::.:::::::::::::::::::::::.:::::::::::::::::::::::.                                  
GCTGCCAAGTCTCCCGACCTGTCAAACCAGAACTCAGACCAGGCCAATGAGGAATGGGAGACTGCG----------------------------------
-A--A--K--S--P--D--L--S--N--Q--N--S--D--Q--A--N--E--E--W--E--T--A-----------------------------------

----------------------------------------------------------------------------------------------------
G--D--K--E--A--P--P--P--V--L--L--T--P--K--A--V--G--T--P--G--G--G--G--G--G--A--V--P--G--I--S--A--M--S
GGGACAAAGAGGCACCCCCACCAGTACTGCTGACACCCAAGGCTGTGGGAACTCCTGGGGGAGGTGGAGGTGGAGCCGTACCAGGTATTTCAGCCATGTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--R--G--D--L--S--Q--R--A--K--D--L--S--K--R--S--F--S--S--Q--R--P--G--M--E--R--Q--N--R--R--P--G--P--G-
CCGCGGAGATCTGAGCCAGAGAGCCAAGGATTTGAGTAAACGGAGCTTCTCAAGTCAGCGGCCAGGCATGGAACGGCAGAATCGGCGCCCTGGCCCAGGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-G--K--A--G--S--S--G--S--S--S--G--G--G--G--G--G--P--G--G--R--T--G--P--G--R--G--D--K--R--S--W--P--S--
GGCAAGGCTGGCAGCAGTGGCAGCAGCAGTGGAGGAGGCGGTGGGGGTCCTGGAGGAAGGACCGGGCCAGGACGAGGCGACAAGAGGAGCTGGCCCTCTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------><--------------------------------------------------------------------------------------
P--K--N--R--S--R--P--P--E--E--R--P--P--G--L--P--L--P--P--P--P--P--S--S--S--A--V--F--R--L--D--Q--V--I
CCAAGAACCGAAGTCGTCCTCCAGAGGAGCGTCCCCCGGGGCTTCCCCTGCCTCCCCCACCTCCCAGCAGTTCTGCTGTCTTCCGCCTGGACCAAGTTAT
                                                  ::::::::.::.::::::::::::::::::::::::::::::::::::::
--------------------------------------------------CCTCCCCCGCCCCCCAGCAGTTCTGCTGTCTTCCGCCTGGACCAAGTTAT
---------------------------------------------------P--P--P--P--P--S--S--S--A--V--F--R--L--D--Q--V--I

----------------------------------------------------------------------------------------------------
--H--S--N--P--A--G--I--Q--Q--A--L--A--Q--L--S--S--R--Q--G--S--V--T--A--P--G--G--H--P--R--H--K--P--G-
CCACAGCAACCCTGCTGGCATCCAACAGGCTCTGGCCCAGCTTAGTAGCCGTCAAGGGAGTGTAACTGCACCAGGGGGTCATCCAAGGCACAAGCCTGGG
::::::::::::::::::::::::::::::::::::::::::.::.:::::.:::::.:.:: ..::::::: ::::: ::.::::::: :::. :::::
CCACAGCAACCCTGCTGGCATCCAACAGGCTCTGGCCCAGCTCAGCAGCCGCCAAGGAAATGGGGCTGCACCTGGGGGGCACCCAAGGCCCAAAACTGGG
--H--S--N--P--A--G--I--Q--Q--A--L--A--Q--L--S--S--R--Q--G--N--G--A--A--P--G--G--H--P--R--P--K--T--G-

------------------------------------------------------------------------------------><--------------
-L--P--Q--A--P--Q--G--P--S--P-----R--P--P--T--R--Y--E--P--Q--R--V--N--S--G--L--S--S--D--P--H--F--E--
CTTCCCCAAGCCCCTCAGGGCCCCTCTCCT---AGGCCCCCAACCCGATACGAGCCCCAGAGGGTCAACAGCGGCCTCAGTTCTGACCCCCACTTTGAGG
:.:.:::::.:::::::.:: :: .: ::     ::::::::.::::.::.:: ::.:::::::.:::::::               :::::::::::::
CCTTCCCAAACCCCTCAAGGACCGCCGCCGCCTCGGCCCCCAGCCCGGTATGACCCTCAGAGGGCCAACAGC---------------CCCCACTTTGAGG
-P--S--Q--T--P--Q--G--P--P--P--P--R--P--P--A--R--Y--D--P--Q--R--A--N--S-----------------P--H--F--E--

----------------------------------------------------------------------------------------------------
E--P--G--P--M--V--R--G--V--G--G--T--P--R--D--S--A--G--V--S--P--F--P--P--K--R--R--E--R--P--P--R--K--P
AGCCGGGGCCAATGGTGAGAGGGGTGGGTGGGACTCCTCGGGACTCTGCCGGGGTTAGTCCCTTTCCCCCTAAACGTCGGGAGCGGCCTCCCAGAAAACC
::::::::::.::::::::.::::::::.::.:: ::.:.:::::::::::::::::.::::::.:::::.::::::::.::.:::::::::::::::::
AGCCGGGGCCGATGGTGAGGGGGGTGGGCGGAACACCCCAGGACTCTGCCGGGGTTAATCCCTTCCCCCCCAAACGTCGAGAACGGCCTCCCAGAAAACC
E--P--G--P--M--V--R--G--V--G--G--T--P--Q--D--S--A--G--V--N--P--F--P--P--K--R--R--E--R--P--P--R--K--P

---------------><-----------------------------------------------------------------------------------
--E--L--L--Q--E--E--S--L--P--P--P--H--S--S--G--F--L--G--S--K--P--E--G--P--G--P--Q--A--E--S--R--D--T-
AGAGCTGCTACAGGAGGAATCTTTGCCACCTCCTCATAGCTCTGGATTCTTGGGCTCTAAGCCTGAGGGCCCAGGCCCTCAGGCAGAGTCCAGAGATACA
.::::::::.::::::::::::::::::.::.::::.: ::::::::::::::::.::::.::.::::::::.:::::::::: :::::::::::::.::
GGAGCTGCTGCAGGAGGAATCTTTGCCATCTTCTCACACCTCTGGATTCTTGGGCCCTAAACCCGAGGGCCCGGGCCCTCAGGGAGAGTCCAGAGATGCA
--E--L--L--Q--E--E--S--L--P--S--S--H--T--S--G--F--L--G--P--K--P--E--G--P--G--P--Q--G--E--S--R--D--A-

---------------------------------------------><-----------------------------------------------------
-G--T--E--A--L--T--P--H--I--W--N--R--L--H--T--A--T--S--R--K--S--Y--R--P--S--S--M--E--P--W--M--E--P--
GGCACAGAGGCCCTGACCCCTCACATCTGGAACCGTTTACATACTGCCACTAGCCGAAAGAGTTACCGGCCCAGCTCCATGGAGCCTTGGATGGAGCCCC
:: :::::::::::.: :::::::::::::::.:::::::::      .::.:::::::: ::::::.:::..::::::::::::: ::::::::.::::
GGAACAGAGGCCCTAAGCCCTCACATCTGGAATCGTTTACAT------GCTGGCCGAAAGCGTTACCAGCCTGGCTCCATGGAGCCGTGGATGGAACCCC
-G--T--E--A--L--S--P--H--I--W--N--R--L--H--------A--G--R--K--R--Y--Q--P--G--S--M--E--P--W--M--E--P--

-------------------------------><-------------------------------------------------------------------
L--S--P--F--E--D--V--A--G--T--E--M--S--Q--S--D--S--G--V--D--L--S--G--D--S--Q--V--S--S--G--P--C--S--Q
TGAGTCCTTTTGAGGATGTGGCTGGCACAGAAATGAGTCAGTCTGACAGTGGGGTGGACCTGAGTGGGGATTCTCAGGTGTCATCAGGTCCCTGCAGCCA
::::::: :::::.:::::::::::::::   ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
TGAGTCCGTTTGAAGATGTGGCTGGCACA---ATGAGTCAGTCTGACAGTGGGGTGGACCTGAGTGGGGATTCTCAGGTGTCATCAGGTCCCTGCAGCCA
L--S--P--F--E--D--V--A--G--T-----M--S--Q--S--D--S--G--V--D--L--S--G--D--S--Q--V--S--S--G--P--C--S--Q

----------------------------------------------------------------------------------------------------
--R--S--S--P--D--G--G--L--K--G--A--A--E--G--P--P--K--R--P--G--G--S--S--P--L--N--A--V--P--C--E--G--P-
GCGAAGTTCCCCTGATGGAGGACTCAAGGGGGCAGCAGAGGGACCCCCCAAGAGGCCTGGAGGCTCCTCACCCCTGAATGCTGTTCCTTGTGAGGGTCCA
::::::::::::::::::::::::::::::::::::::: ::.:.::::::: :::::::::::.::::::::::::::::::::::: :::::::::::
GCGAAGTTCCCCTGATGGAGGACTCAAGGGGGCAGCAGACGGGCTCCCCAAGCGGCCTGGAGGCCCCTCACCCCTGAATGCTGTTCCTGGTGAGGGTCCA
--R--S--S--P--D--G--G--L--K--G--A--A--D--G--L--P--K--R--P--G--G--P--S--P--L--N--A--V--P--G--E--G--P-

-----------------------------------------------------------------><---------------------------------
-P--G--S--E--P-----------P--R--R--P--P--P--A--P--H--D--G--D--R--K--E--L--P--R--E--Q--P--L--P--P--G--
CCTGGCTCTGAACCT---------CCTAGGAGACCACCACCTGCCCCCCACGATGGGGACAGAAAGGAGCTGCCCCGGGAGCAGCCTCTGCCCCCTGGCC
::::::::::::::.         :::::::::: .::::::::::::::.::::::::.:::::::::::::: ::::::::::::::::::::::: :
CCTGGCTCTGAACCCTCTGAACCTCCTAGGAGACGGCCACCTGCCCCCCATGATGGGGATAGAAAGGAGCTGCCACGGGAGCAGCCTCTGCCCCCTGGGC
-P--G--S--E--P--S--E--P--P--R--R--R--P--P--A--P--H--D--G--D--R--K--E--L--P--R--E--Q--P--L--P--P--G--

----------------------------------------------------------------------------------------------------
P--I--G--T--E--R--S--Q--R--T--D--R--G--T--E--P--G--P--I--R--P--S--H--R--P--G--P--P--V--Q--F--G--T--S
CCATTGGCACAGAACGATCACAGCGTACAGACCGAGGCACAGAGCCTGGCCCCATTCGGCCATCCCATCGACCTGGTCCCCCAGTCCAGTTTGGCACTAG
:::::::::::::.::::..:::::::::::::::::: ::::::::.::.:: :.:::.:. ::::::::::::::::::::::::::::::::::.::
CCATTGGCACAGAGCGATTGCAGCGTACAGACCGAGGCCCAGAGCCTAGCTCCCTCCGGTCGGCCCATCGACCTGGTCCCCCAGTCCAGTTTGGCACCAG
P--I--G--T--E--R--L--Q--R--T--D--R--G--P--E--P--S--S--L--R--S--A--H--R--P--G--P--P--V--Q--F--G--T--S

------><----------------------------------------------------------------------><--------------------
--D--K--D--S--D--L--R--L--V--V--G--D--S--L--K--A--E--K--E--L--T--A--S--V--T--E--A--I--P--V--S--R--D-
TGACAAGGACTCAGACTTACGCCTAGTGGTAGGAGACAGCTTGAAAGCAGAGAAGGAGCTAACAGCATCAGTCACTGAGGCCATTCCTGTATCACGAGAC
::::::::::::.::.::..:::::::::::::::::::.::.::::::::::::::::::::.::::::::::: :::::::::::..:  : ::::::
TGACAAGGACTCGGATTTGTGCCTAGTGGTAGGAGACAGTTTAAAAGCAGAGAAGGAGCTAACGGCATCAGTCACGGAGGCCATTCCCATCGCTCGAGAC
--D--K--D--S--D--L--C--L--V--V--G--D--S--L--K--A--E--K--E--L--T--A--S--V--T--E--A--I--P--I--A--R--D-

----------------------------------------------------------------------------------------------------
-W--E--L--L--P--S--A--A--A--S--A--E--P--Q--S--K--N--L--D--S--G--H--C--V--P--E--P--S--S--S--G--Q--R--
TGGGAGCTGCTTCCCAGTGCTGCTGCCTCTGCTGAGCCACAATCCAAGAACCTGGATTCTGGGCACTGTGTCCCGGAGCCCAGCTCCTCAGGCCAGCGCC
:::::::::::.::::::::: ::::.:: :::::::: ::.:::::::.:::::.::::: .::::::: :::.::::::::::::::::::::.:::.
TGGGAGCTGCTCCCCAGTGCTTCTGCTTCAGCTGAGCCTCAGTCCAAGAGCCTGGGTTCTGCACACTGTGGCCCAGAGCCCAGCTCCTCAGGCCAACGCT
-W--E--L--L--P--S--A--S--A--S--A--E--P--Q--S--K--S--L--G--S--A--H--C--G--P--E--P--S--S--S--G--Q--R--

----------------------------------------------><----------><-------------------------------><-------
L--Y--P--E--V--F--Y--G--S--A--G--P--S--S--S--Q--I--S--G--G--H--G--L--S--I--T--S--K--Q--W--R--R--P--G
TGTATCCTGAGGTTTTCTATGGCAGTGCTGGGCCTTCCAGTTCTCAGATCTCTGGGGGACATGGACTCTCAATTACATCCAAACAGTGGAGGCGCCCTGG
::::.::::::::.:::::::::::. ::::::::.:::::::::::                                             ::::::::
TGTACCCTGAGGTCTTCTATGGCAGCCCTGGGCCTCCCAGTTCTCAG---------------------------------------------CGCCCTGG
L--Y--P--E--V--F--Y--G--S--P--G--P--P--S--S--Q-----------------------------------------------R--P--G

-----------------------><---------------------------------------------------------------------------
--T--P--S--L--H--P--Y--R--S--Q--P--L--Y--L--P--P--G--P--A--P--P--S--A--L--L--S--G--L--A--L--K--G--Q-
GACACCCTCACTGCACCCTTACAGATCACAGCCCCTATACCTACCCCCCGGCCCAGCCCCTCCCTCAGCACTGCTCTCTGGGTTAGCTCTCAAGGGCCAG
::::::::::::::::::::::   ::::::::::::::.::.::::: ::::::::::: ::::::::::::::::::::: ::::. :::::::::::
GACACCCTCACTGCACCCTTAC---TCACAGCCCCTATATCTGCCCCCGGGCCCAGCCCCACCCTCAGCACTGCTCTCTGGGGTAGCCGTCAAGGGCCAG
--T--P--S--L--H--P--Y-----S--Q--P--L--Y--L--P--P--G--P--A--P--P--S--A--L--L--S--G--V--A--V--K--G--Q-

----------------------------------------------------------------------------------------------------
-F--L--D--F--S--T--M--Q--A--T--E--L--G--K--L--P--A--G--G--V--L--Y--P--P--P--S--F--L--Y--S--P--A--F--
TTTCTGGATTTCTCCACAATGCAAGCTACAGAGCTGGGGAAGTTGCCGGCTGGAGGAGTTCTCTACCCTCCACCTTCCTTCCTCTACTCTCCGGCTTTCT
:::::::::::::: .:: ::::::: .::::.::::::::::::::.::.::::::::::::: :::::::::::::::::::::::::::.:::::::
TTTCTGGATTTCTCAGCACTGCAAGCAGCAGAACTGGGGAAGTTGCCAGCCGGAGGAGTTCTCTTCCCTCCACCTTCCTTCCTCTACTCTCCAGCTTTCT
-F--L--D--F--S--A--L--Q--A--A--E--L--G--K--L--P--A--G--G--V--L--F--P--P--P--S--F--L--Y--S--P--A--F--

----------------------------------><----------------------------------------------------------------
C--P--S--P--L--P--D--T--S--L--L--Q--V--R--Q--D--L--P--S--P--S--D--F--Y--S--T--P--L--Q--P--G--G--Q--S
GCCCCAGTCCTTTGCCTGACACATCGTTGCTTCAGGTACGCCAGGATCTGCCATCCCCTTCGGATTTTTATTCTACTCCTCTGCAGCCTGGTGGCCAAAG
::::.::.:::::::: ::. ::.: ::::: :::            :::::::::::.::.:::::::::::::::::::::::.:::::::::::.::
GCCCTAGCCCTTTGCCAGATCCACCCTTGCTGCAG------------CTGCCATCCCCCTCAGATTTTTATTCTACTCCTCTGCAACCTGGTGGCCAGAG
C--P--S--P--L--P--D--P--P--L--L--Q--------------L--P--S--P--S--D--F--Y--S--T--P--L--Q--P--G--G--Q--S

---------------------------------><-----------------------------------------------------------------
--G--F--L--P--S--G--A--P--A--Q--Q--M--L--L--P--M--V--D--S--Q--L--P--V--V--N--F--G--S--L--P--P--A--P-
TGGCTTTCTCCCTTCAGGGGCTCCTGCCCAGCAGATGCTTCTACCCATGGTAGACTCACAGCTGCCTGTGGTGAACTTTGGCTCCCTGCCGCCAGCACCA
:::.::.:::::.::.:::::::::::::::::::::::::::::::::::.::::::::::::::::::::.:::::::::::::::::.:::::::::
TGGTTTCCTCCCCTCGGGGGCTCCTGCCCAGCAGATGCTTCTACCCATGGTGGACTCACAGCTGCCTGTGGTAAACTTTGGCTCCCTGCCACCAGCACCA
--G--F--L--P--S--G--A--P--A--Q--Q--M--L--L--P--M--V--D--S--Q--L--P--V--V--N--F--G--S--L--P--P--A--P-

----------------------------------------------------------------------------------------------------
-P--P--A--P--P--P--L--S--L--L--P--V--G--P--A--L--Q--P--P--S--L--A--V--R--P--P--P--A--P--A--T--R--V--
CCTCCTGCCCCACCTCCCCTTTCTCTGTTACCTGTGGGCCCTGCTCTGCAGCCCCCCAGCCTGGCTGTGCGGCCCCCACCTGCTCCTGCTACTCGGGTGC
::::::::.::::: :::::::::::::::::::::::.:::::.:::::::::::::::::::::::::::::.::.::::::::::::.:::::::::
CCTCCTGCTCCACCGCCCCTTTCTCTGTTACCTGTGGGTCCTGCCCTGCAGCCCCCCAGCCTGGCTGTGCGGCCTCCGCCTGCTCCTGCTGCTCGGGTGC
-P--P--A--P--P--P--L--S--L--L--P--V--G--P--A--L--Q--P--P--S--L--A--V--R--P--P--P--A--P--A--A--R--V--

----------------------------------------------><----------------------------------------------------
L--P--S--P--A--R--P--F--P--A--S--L--G--R--A--E--L--H--P--V--E--L--K--P--F--Q--D--Y--Q--K--L--S--S--N
TGCCTTCACCTGCCAGGCCCTTCCCCGCTAGCTTGGGGCGAGCAGAGCTGCATCCAGTGGAACTAAAGCCGTTCCAGGATTATCAAAAACTGAGCAGCAA
:::::::::: :::::::::::.  : :::::::::::::::::::::::::.:: ::.:::::::::::::::::::::::.:.::::::::.::::::
TGCCTTCACCGGCCAGGCCCTTTGGCCCTAGCTTGGGGCGAGCAGAGCTGCACCCTGTAGAACTAAAGCCGTTCCAGGATTACCGAAAACTGAACAGCAA
L--P--S--P--A--R--P--F--G--P--S--L--G--R--A--E--L--H--P--V--E--L--K--P--F--Q--D--Y--R--K--L--N--S--N

-----------------------------------------><---------------------------------------------------------
--L--G--G--P--G--S--S--R--T--P--P--T--G--R--S--F--S--G--L--N--S--R--L--K--A--T--P--S--T--Y--S--G--V-
CCTTGGGGGACCTGGATCATCACGGACTCCCCCAACTGGAAGGTCCTTCTCTGGCCTCAATTCCCGTCTCAAGGCCACGCCTTCCACCTACAGTGGAGTC
:::::::::::::::.::.::::: :::::::::.:::::   ::.:::::::::::::::::::::::::::::: :.::::::::::::::::::::.
CCTTGGGGGACCTGGGTCGTCACGTACTCCCCCAGCTGGA---TCTTTCTCTGGCCTCAATTCCCGTCTCAAGGCCCCACCTTCCACCTACAGTGGAGTT
--L--G--G--P--G--S--S--R--T--P--P--A--G-----S--F--S--G--L--N--S--R--L--K--A--P--P--S--T--Y--S--G--V-

--------------------------------><------------------------------------------------------------------
-F--R--T--Q--R--V--D--L--Y--Q--Q--A--S--P--P--D--A--L--R--W--I--P--K--P--W--E--R--T--G--P--P--P--R--
TTCCGCACCCAGCGCGTCGACCTTTACCAGCAGGCCTCCCCACCAGATGCCCTGCGCTGGATACCTAAGCCTTGGGAGCGGACAGGGCCGCCACCTCGAG
:::::::::::::::.:::::::.::::::::::::::::::::::::::::::::::::::.:: :::::::::::::::::::::::.:::.::::::
TTCCGCACCCAGCGCATCGACCTCTACCAGCAGGCCTCCCCACCAGATGCCCTGCGCTGGATGCCGAAGCCTTGGGAGCGGACAGGGCCACCATCTCGAG
-F--R--T--Q--R--I--D--L--Y--Q--Q--A--S--P--P--D--A--L--R--W--M--P--K--P--W--E--R--T--G--P--P--S--R--

------------------------------------------------------------------------->
E--G--P--S--R--R--A--E--E--P--G--S--R--G--D--K--E--P--G--L--P--P--P--R--*-
AAGGGCCCTCCCGACGGGCAGAGGAGCCTGGGTCCCGAGGGGACAAGGAGCCTGGGTTGCCCCCACCCCGCTGA
::::::: :::::: :::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::
AAGGGCCATCCCGAAGGGCAGAGGAGCCCGGGTCCCGAGGGGACAAGGAGCCTGGGTTGCCCCCACCCCGCTGA
E--G--P--S--R--R--A--E--E--P--G--S--R--G--D--K--E--P--G--L--P--P--P--R--*-

Pig Consensus Sequence

>BGISUST0000895120
ATGTCCGATCGCTCGGGGCCGACTGCCAAGGGGAAGGATGGAAAGAAGTATTCCTCGCTCAACCTGTTTGATACGTATAAGGGCAAGTCCTTAGAGATCC
AGAAACCCGCT------TGCCCCTCGCCATGGCCTGCAGAGTCTCGGGAAAGTTGCTATTGCTCGGCGTATCCCCCAGCCAACCTTCCAAGCCTGAAAGC
CGAGAACAAAGGCAATGACCCCAACGTCTCACTAGTGCCGAAAGACGGAACAGGATGGGCAAGCAAACAGGAGCAGTCCGACCCCAAG---TCCGATGCC
TCAACCGCTCAGCCGCCGGAATCGCAGCCACTGCCGGCTTCACAGACGCCTGCCTCCAACCAACCGAAACGACCCCCAGCAGCCCCAGAGAACACTCCTT
CGGTTCCAAGCGGGGTAAAGTCCTGGGCACAAGCCAGCGTCACCCATGGAGCACATGGAGAT---GGAAGGGCATCAAGCCTACTGTCACGATTCTCTCG
AGAGGAATTTCCGACCCTGCAGGCGGCTGGCGACCAGGACAAGGCTGCCAAGGAAAGGGAGTCTGCCGAACAGTCGTCTGGGCCCGGACCAAGCCTCCGC
CCCCAA---TCCACAACTTGGAGGGACGGAGGTGGGCGTGGCCCTGATGAGCTGGAGGGCCCGGACTCCAAACTTCATCACGGCCATGATCCCCGGGGTG
GGCTGCAGCCTTCAGGCCCACCCCAGTTCCCTCCCTACCGCGGAATGATGCCGCCC---------------------------------CCCTATGGACC
CCAGGGGCCTTACCGATACCCCGCTCCTGATGGG------CGTTTCCCCCGTGTGGCAGGCCCCCGAGGCTCAGGGCCACCAATGCGCCTCGTAGAGCCT
GTGGGTCGGCCTTCCATTCTTAAAGAAGATAATCTCAAAGAGTTTGACCAGTTGGACCAGGAGAATGATGATGGTTGGGCA---GCCCATGAGGAGGTCG
ACTACACTGAGAAGCTCAAGTTCAGCGATGAGGAAGACGGGCGAGACTCTGATGAGGAGGGAGCTGAGGGC---AAGGAGTCCCAGGCAGCTGGCGGTGA
GGAACGGCCCCCTGAAGCAGATGGCAAAAAGGGCAACTCCCCCGGCAGCGAACCGCCCCCTCCCAAGACGGCCTGGGCAGAGACCTCTCGGCCTCCAGAG
ACAGAGCCGGGGCCTCCTGCCCCAAAGCCTCCCCCACCCCCACCTCACCGGGGCCCCGCCGGGAACTGGGGCCCCCCTGGGGACTACCCAGATCGAGGGG
GCCCTCCCTGCAGggCCCCAGCACCTGAAGACGAGGATGAGGCATGGCGACAGCGGCGGAAGCAGTCTTCATCTGAGATCTCCCTGGCTGTGGAGCGGGC
CCGGCGGCGGCGAGAGGAGGAGGAGCGACGCATGCAAGAGGAGCGCAGGGCTGCCTGTGCCGAGAAGCTCAAGCGACTTGATGAGAAGTTTGGGGCACCC
GACAAGCGGCTCAAGGCAGAGCCTGCGGCACCACCCGCTGTCCCTCCTGCCCCCGCTCCACCACCTGCAGTCCCCAAAGAACTCCCCACACCTCCAGCAC
CTTCACCGGCACCAGTCCCAACACCTGAAAAAGAACCAGAAGAGCCGGCACAGGCCCCTCCTGCCCAGTCCACCCCCACTCCAGGTGTGGCTCCAGCTCC
CACCCTGGTGAGTGGTGGTGGCAGTACCAGTAGCACCAGCAGTGGCAGCTTCGAAGCCAGCCCA---GAACCCCAGCTGCCCTCAAAAGAGGGTCCTGAA
TCACCAGAAGAGGTTCCTGCACCTGCCACACCGCCAGCACCAAAGGTGGAACCCAAGGGTGATGGGATTGGTCCTACCCGGCAGCCCCCCAGCCAAGGCT
TAGGCTACCCTAAATATCAGAAGTCATTGCCGCCTCGTTTCCAGCGGCAACAGCAGGAGCAGCTCTTAAAGCAGCAACAACAGCAGCAGTGGCAGCAGCA
TCAACAGGGCTCTGCCCCACCTGCCCCAGTACCCCCGTCACCACCACAGCCTGTGACTATGGGGGCTGTGCCGGCTCCACAGGCTGCTCCACCACCCCCA
AAGGCC----------------------------------------------------------------------------------------------
--------------------------------------------------------CTAGTTCCCCGGGAGCGCTCAGACAGTGGAGGCTCAAGTTCAGA
GCCATTTGAGCGCCATGCAGCCCCCCTCTTACGAGATCGGGGCACCCCACCAGTGGATCCAAAGTTGGCCTGGGTAGGAGATGTCTTCACCACCACAGCC
ACTGACTCCCGCCCCCTTACCTCACCACTGCGCCAGGCTACCGACGAGGAGGACAAGGGGATG---AGCGAGACCCCTCCAGTACCCCCACCGCCCTATC
TGGCCAGTTATCCAGGCTTTCCCGAAAATGGAGCCCCTGGACCCCCGATTCCTCGCTTCCCTCTGGAG--------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------CCTCCCCCCATCTGCCCAGGCTGGAGCCCTCCAACCAAGTCCCTGGCTCCGAAGAAGCCTCCAACGGGTCCTTTGCCACCAAGTAAGGAG
CCTTTGAAAGAGAAGCTGCTCACAGGGCCTCTGTCCCCTGTGGCCCGCGGAGGCAGCAGTGGAGGCAGTAACATGGGCCTGGGTGTGGAAGATGGGGAGC
GGCCCAGAAGGAGGCGACACGGGAGGGCTCAGCAGCAGGACAAACCACCTCGCTTCCGGAGGCTGAAGCAGGAACGGGAGAATGCTGCGAGGGGGGCCGA
GGGCAAGCCCTCTTCCCTATCCCTGTCAACCTCGGCTCCGGGACCGGAGGAGGCCCTCCCCACGGTAGCAGTGCCCCCACCGCCTCGCCGGGCAGCTGCC
AAGTCTCCCGACCTGTCAAACCAGAACTCAGACCAGGCCAATGAGGAATGG-------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-----------------------------------CCTCCCCCGCCCCCCAGCAGTTCTGCTGTCTTCCGCCTGGACCAAGTTATCCACAGCAACCCTGC
TGGCATCCAACAGGCTCTGGCCCAGCTCAGCAGCCGCCAAGGAAATGGGGCTGCACCTGGGGGGCACCCAAGGCCCAAAACTGGGCCTTCCCAAACCCCT
CAAGGACCGCCGCCGCCTCGGCCCCCAGCCCGGTATGACCCTCAGAGGGCCAAC---------------CCCCACTTTGAGGAGCCGGGGCCGATGGTGA
GGGGGGTGGGCGGAACACCCCAGGACTCTGCCGGGGTTAATCCCTTCCCCCCCAAACGTCGAGAACGGCCTCCCAGAAAACCGGAGCTGCTGCAGGAGGA
ATCTTTGCCATCTTCTCACACCTCTGGATTCTTGGGCCCTAAACCCGAGGGCCCGGGCCCTCAGGGAGAGTCCAGAGATGCAGGAACAGAGGCCCTAAGC
CCTCACATCTGGAATCGTTTACAT------GCTGGCCGAAAGCGTTACCAGCCTGGCTCCATGGAGCCGTGGATGGAACCCCTGAGTCCGTTTGAAGATG
TGGCTGGCACA---ATGAGTCAGTCTGACAGTGGGGTGGACCTGAGTGGGGATTCTCAGGTGTCATCAGGTCCCTGCAGCCAGCGAAGTTCCCCTGATGG
AGGACTCAAGGGGGCAGCAGACGGGCTCCCCAAGCGGCCTGGAGGCCCCTCACCCCTGAATGCTGTTCCTGGTGAGGGTCCACCTGGCTCTGAACCCTCT
GAACCTCCTAGGAGACGGCCACCTGCCCCCCATGATGGGGAGCTGCCACGGGAGCAGCCTCTGCCCCCTGGGCCCATTGGCACAGAGCGATTGCAGCGTA
CAGACCGAGGCCCAGAGCCTAGCTCCCTCCGGTCGGCCCATCGACCTGGTCCCCCAGTCCAGTTTGGCACCAGTGACAAGGACTCGGATTTGTGCCTAGT
GGTAGGAGACAGTTTAAAAGCAGAGAAGGAGCTAACGGCATCAGTCACGGAGGCCATTCCCATCGCTCGAGACTGGGAGCTGCTCCCCAGTGCTTCTGCT
TCAGCTGAGCCTCAGTCCAAGAGCCTGGGTTCTGCACACTGTGGCCCAGAGCCCAGCTCCTCAGGCCAACGCTTGTACCCTGAGGTCTTCTATGGCAGCC
CTGGGCCTCCCAGTTCTCAG---------------------------------------------CGCCCTGGGACACCCTCACTGCACCCTTAC---TC
ACAGCCCCTATATCTGCCCCCGGGCCCAGCCCCACCCTCAGCACTGCTCTCTGGGGTAGCCGTCAAGGGCCAGTTTCTGGATTTCTCAGCACTGCAAGCA
GCAGAACTGGGGAAGTTGCCAGCCGGAGGAGTTCTCTTCCCTCCACCTTCCTTCCTCTACTCTCCAGCTTTCTGCCCTAGCCCTTTGCCAGATCCACCCT
TGCTGCAG------------CTGCCATCCCCCTCAGATTTTTATTCTACTCCTCTGCAACCTGGTGGCCAGAGTGGTTTCCTCCCCTCGGGGGCTCCTGC
CCAGCAGATGCTTCTACCCATGGTGGACTCACAGCTGCCTGTGGTAAACTTTGGCTCCCTGCCACCAGCACCACCTCCTGCTCCACCGCCCCTTTCTCTG
TTACCTGTGGGTCCTGCCCTGCAGCCCCCCAGCCTGGCTGTGCGGCCTCCGCCTGCTCCTGCTGCTCGGGTGCTGCCTTCACCGGCCAGGCCCTTTGGCC
CTAGCTTGGGGCGAGCAGAGCTGCACCCTGTAGAACTAAAGCCGTTCCAGGATTACCGAAAACTGAACAGCAACCTTGGGGGACCTGGGTCGTCACGTAC
TCCCCCAGCTGGA---TCTTTCTCTGGCCTCAATTCCCGTCTCAAGGCCCCACCTTCCACCTACAGTGGAGTTTTCCGCACCCAGCGCATCGACCTCTAC
CAGCAGGCCTCCCCACCAGATGCCCTGCGCTGGATGCCGAAGCCTTGGGAGCGGACAGGGCCACCATCTCGAGAAGGGCCATCCCGAAGGGCAGAGGAGC
CCGGGTCCCGAGGGGACAAGGAGCCTGGGTTGCCCCCACCCCGCTGA


>BGISUSP0000895120
MSDRSGPTAKGKDGKKYSSLNLFDTYKGKSLEIQKPA--CPSPWPAESRESCYCSAYPPANLPSLKAENKGNDPNVSLVPKDGTGWASKQEQSDPK-SDA
STAQPPESQPLPASQTPASNQPKRPPAAPENTPSVPSGVKSWAQASVTHGAHGD-GRASSLLSRFSREEFPTLQAAGDQDKAAKERESAEQSSGPGPSLR
PQ-STTWRDGGGRGPDELEGPDSKLHHGHDPRGGLQPSGPPQFPPYRGMMPP-----------PYGPQGPYRYPAPDG--RFPRVAGPRGSGPPMRLVEP
VGRPSILKEDNLKEFDQLDQENDDGWA-AHEEVDYTEKLKFSDEEDGRDSDEEGAEG-KESQAAGGEERPPEADGKKGNSPGSEPPPPKTAWAETSRPPE
TEPGPPAPKPPPPPPHRGPAGNWGPPGDYPDRGGPPCRAPAPEDEDEAWRQRRKQSSSEISLAVERARRRREEEERRMQEERRAACAEKLKRLDEKFGAP
DKRLKAEPAAPPAVPPAPAPPPAVPKELPTPPAPSPAPVPTPEKEPEEPAQAPPAQSTPTPGVAPAPTLVSGGGSTSSTSSGSFEASP-EPQLPSKEGPE
SPEEVPAPATPPAPKVEPKGDGIGPTRQPPSQGLGYPKYQKSLPPRFQRQQQEQLLKQQQQQQWQQHQQGSAPPAPVPPSPPQPVTMGAVPAPQAAPPPP
KA--------------------------------------------------LVPRERSDSGGSSSEPFERHAAPLLRDRGTPPVDPKLAWVGDVFTTTA
TDSRPLTSPLRQATDEEDKGM-SETPPVPPPPYLASYPGFPENGAPGPPIPRFPLE--------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------PPPICPGWSPPTKSLAPKKPPTGPLPPSKE
PLKEKLLTGPLSPVARGGSSGGSNMGLGVEDGERPRRRRHGRAQQQDKPPRFRRLKQERENAARGAEGKPSSLSLSTSAPGPEEALPTVAVPPPPRRAAA
KSPDLSNQNSDQANEEW-----------------------------------------------------------------------------------
---------------------------------------------PPPPPSSSAVFRLDQVIHSNPAGIQQALAQLSSRQGNGAAPGGHPRPKTGPSQTP
QGPPPPRPPARYDPQRAN-----PHFEEPGPMVRGVGGTPQDSAGVNPFPPKRRERPPRKPELLQEESLPSSHTSGFLGPKPEGPGPQGESRDAGTEALS
PHIWNRLH--AGRKRYQPGSMEPWMEPLSPFEDVAGT-MSQSDSGVDLSGDSQVSSGPCSQRSSPDGGLKGAADGLPKRPGGPSPLNAVPGEGPPGSEPS
EPPRRRPPAPHDGELPREQPLPPGPIGTERLQRTDRGPEPSSLRSAHRPGPPVQFGTSDKDSDLCLVVGDSLKAEKELTASVTEAIPIARDWELLPSASA
SAEPQSKSLGSAHCGPEPSSSGQRLYPEVFYGSPGPPSSQ---------------RPGTPSLHPY-SQPLYLPPGPAPPSALLSGVAVKGQFLDFSALQA
AELGKLPAGGVLFPPPSFLYSPAFCPSPLPDPPLLQ----LPSPSDFYSTPLQPGGQSGFLPSGAPAQQMLLPMVDSQLPVVNFGSLPPAPPPAPPPLSL
LPVGPALQPPSLAVRPPPAPAARVLPSPARPFGPSLGRAELHPVELKPFQDYRKLNSNLGGPGSSRTPPAG-SFSGLNSRLKAPPSTYSGVFRTQRIDLY
QQASPPDALRWMPKPWERTGPPSREGPSRRAEEPGSRGDKEPGLPPPR*