Sequences
rnbm18b_i23.y1est
CN026542est
CN025367est
CN024973est
CN026193est
rcad22b_p8.y1est
reye1608b_n16.y1est
CN032407est
CN025525est
DY405461est
CN027195est
CN026033est
CN025542est
CN025037est
CN025218est
CX065789est
DY406067est
AW312492est
DN111633est
CN030174est
CN031180est
CN030426est
CN025935est
CO943696est
reru26c_p24.y1est
DN134134est
rece06c_m19.y1est
recc2802c_o14.y1est
CO945314est
BI181610est
rcly12b_d5.y1est
rcbl0_023636.y1est
rplac_8941.y1est
rcov15b_h24.y1est
CN032200est
CN026161est
CN032248est
CN025611est
CN025583est
reje28b_p7.y1est
CB482235est
CN167142est
rmed28c_m3.y1est
DY413329est
BI181993est
DY406833est
rnms38_b10.y1est
CN025799est
rcly31b_j15.y1est
CN025476est
BI339171est
CN025517est
CN025382est
BG833908est
rnms09_n19.y1est
rnca22b_n18.y1est
CN030942est
relu1302b_n23.y1est
CN031185est
CN025185est
CN025948est
CN032693est
raor011_f14.y1est
rrec10_n7.y1est
CN025154est
CN025894est
recc2823c_f21.y1est
CN025123est
BI132721est
rhlv29b_p8.y1est
CN025874est
CN026042est
rnbm05b_k15.y1est
CN025115est
rfbs3936b_m24.y1est
ramn3507b_j8.y1est
reru11c_b10.y1est
BI403351est
dpcxb0_183750.z1reads
CN025470est
CN024971est
rnco1908b_a19.y1est
CN025480est
CO951447est
CN026147est
rjej18b_l23.y1est
rnmm30c_d17.y1est
CN025320est
CN030258est
CN032215est
rmed08c_o3.y1est
rcsp27b_a7.y1est
CN024976est
BP448960est
AJ648109est
rnlu1816b_p9.y1est
DY404732est
DY417390est
CN030195est
rcly28b_g16.y1est
CN026159est
F23125est
BE013084est
rsag011_a2.y1est
CN025811est
CN026146est
DW337718est
CV877542est
CN025743est
rbda_86484.y1reads
CN025180est
AJ458085est
EST Library Info
aor1Aorta
cad2Unavailable
cbl3Blood
cly7Lymph - RNA from China
cov1Ovary - RNA from China
ecc5Foetus 50 days, cortex cerebri
ece2Foetus 50 days, cerebellum
eje2Foetus 50 days, jejunum
eru2Foetus 50 days, regio umbilicalis
eye1Foetus 50 days, Eye
fbs1Unavailable
hlv1Heart, left ventricle
jej1Small intestine, jejunum
med2Mediastinum
nbm2Newborn 115 days, bone marrow (pelvis)
nca2Newborn 115 days, cartillage
nco2Newborn 115 days, colon
nlu2Newborn 115 days, lung
nmm2Newborn 115 days, mucosal membranes
nms2Newborn 115 days, M. semitendinosus
plac3Unavailable
rec1Rectum
relu2Unavailable
sag1Salivary gland
Clusters
Oligos
SNPs

Gene ID ENSG00000111968 (click for geneview)
Transcript ID ENST00000229695(link to ensembl)
Symbol CSNK2B
Localtion Chromosome:6:31741636:31745822:1 band: 6p21.33
Description Casein kinase II beta subunit (CK II beta) (Phosvitin) (G5a).
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<----------------------------------------------------------------------><---------------------------
-M--S--S--S--E--E--V--S--W--I--S--W--F--C--G--L--R--G--N--E--F--F--C--E--V--D--E--D--Y--I--Q--D--K--
ATGAGCAGCTCAGAGGAGGTGTCCTGGATTTCCTGGTTCTGTGGGCTCCGTGGCAATGAATTCTTCTGTGAAGTGGATGAAGACTACATCCAGGACAAAT
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
ATGAGCAGCTCAGAGGAGGTGTCCTGGATTTCCTGGTTCTGTGGGCTCCGTGGCAATGAATTCTTCTGTGAAGTGGATGAAGACTACATCCAGGACAAAT
-M--S--S--S--E--E--V--S--W--I--S--W--F--C--G--L--R--G--N--E--F--F--C--E--V--D--E--D--Y--I--Q--D--K--

--------------------------------------------------------------------------><------------------------
F--N--L--T--G--L--N--E--Q--V--P--H--Y--R--Q--A--L--D--M--I--L--D--L--E--P--D--E--E--L--E--D--N--P--N
TTAATCTTACTGGACTCAATGAGCAGGTCCCTCACTATCGACAAGCTCTAGACATGATCTTGGACCTGGAGCCTGATGAAGAACTGGAAGACAACCCCAA
:.:::::.:::::::::::.:::::::: :::::.:::::::::::.:::::::::::::::::::::::.:::   ::.::.:::::::::::::::::
TCAATCTCACTGGACTCAACGAGCAGGTGCCTCATTATCGACAAGCCCTAGACATGATCTTGGACCTGGAACCT---GAGGAGCTGGAAGACAACCCCAA
F--N--L--T--G--L--N--E--Q--V--P--H--Y--R--Q--A--L--D--M--I--L--D--L--E--P-----E--E--L--E--D--N--P--N

------------------------------------------------------------------------------------------><--------
--Q--S--D--L--I--E--Q--A--A--E--M--L--Y--G--L--I--H--A--R--Y--I--L--T--N--R--G--I--A--Q--M--L--E--K-
CCAGAGTGACCTGATTGAGCAGGCAGCCGAGATGCTTTATGGATTGATCCACGCCCGCTACATCCTTACCAACCGTGGCATCGCCCAGATGTTGGAAAAG
::::::::::::::::::::::::::::::.:::::.:::::::::::::::::::::::.:::::.:::::::::::::::::::::::::::::::::
CCAGAGTGACCTGATTGAGCAGGCAGCCGAAATGCTCTATGGATTGATCCACGCCCGCTATATCCTCACCAACCGTGGCATCGCCCAGATGTTGGAAAAG
--Q--S--D--L--I--E--Q--A--A--E--M--L--Y--G--L--I--H--A--R--Y--I--L--T--N--R--G--I--A--Q--M--L--E--K-

------------------------------------------------------------------><--------------------------------
-Y--Q--Q--G--D--F--G--Y--C--P--R--V--Y--C--E--N--Q--P--M--L--P--I--G--L--S--D--I--P--G--E--A--M--V--
TACCAGCAAGGAGACTTTGGTTACTGTCCTCGTGTGTACTGTGAGAACCAGCCAATGCTTCCCATTGGCCTTTCAGACATCCCAGGTGAAGCCATGGTGA
::::::::.:::::::::::.::::::::.:::::::::::::::::::::::::::::::::      :::::.:::::::::::.::.::::::::::
TACCAGCAGGGAGACTTTGGCTACTGTCCCCGTGTGTACTGTGAGAACCAGCCAATGCTTCCC------CTTTCGGACATCCCAGGCGAGGCCATGGTGA
-Y--Q--Q--G--D--F--G--Y--C--P--R--V--Y--C--E--N--Q--P--M--L--P--------L--S--D--I--P--G--E--A--M--V--

----------------------------------------------------------------------------------------------------
K--L--Y--C--P--K--C--M--D--V--Y--T--P--K--S--S--R--H--H--H--T--D--G--A--Y--F--G--T--G--F--P--H--M--L
AGCTCTACTGCCCCAAGTGCATGGATGTGTACACACCCAAGTCATCAAGACACCATCACACGGATGGCGCCTACTTCGGCACTGGTTTCCCTCACATGCT
:::::::::::::::::::::::::.::::::::.:::::::::::.::.:::::.::::::::::::::::::::::::::.:::::::::::::::::
AGCTCTACTGCCCCAAGTGCATGGACGTGTACACGCCCAAGTCATCGAGGCACCACCACACGGATGGCGCCTACTTCGGCACCGGTTTCCCTCACATGCT
K--L--Y--C--P--K--C--M--D--V--Y--T--P--K--S--S--R--H--H--H--T--D--G--A--Y--F--G--T--G--F--P--H--M--L

--------------------------------------------------------><------------------------------------------
--F--M--V--H--P--E--Y--R--P--K--R--P--A--N--Q--F--V--P--R--L--Y--G--F--K--I--H--P--M--A--Y--Q--L--Q-
CTTCATGGTGCATCCCGAGTACCGGCCCAAGAGACCTGCCAACCAGTTTGTGCCCAGGCTCTACGGTTTCAAGATCCATCCGATGGCCTACCAGCTGCAG
::::::::::::.:::::::::::::::::. :.:::::::::::::::::::::   :::::::::::::::::::::::.::::::::::::::::::
CTTCATGGTGCACCCCGAGTACCGGCCCAAACGGCCTGCCAACCAGTTTGTGCCC---CTCTACGGTTTCAAGATCCATCCAATGGCCTACCAGCTGCAG
--F--M--V--H--P--E--Y--R--P--K--R--P--A--N--Q--F--V--P-----L--Y--G--F--K--I--H--P--M--A--Y--Q--L--Q-

----------------------------------------------->
-L--Q--A--A--S--N--F--K--S--P--V--K--T--I--R--*-
CTCCAAGCCGCCAGCAACTTCAAGAGCCCAGTCAAGACGATTCGCTGA
:::::::::::::::::::::::::::::.::::::::.:::::::::
CTCCAAGCCGCCAGCAACTTCAAGAGCCCGGTCAAGACAATTCGCTGA
-L--Q--A--A--S--N--F--K--S--P--V--K--T--I--R--*-

Pig Consensus Sequence

>BGISUST0000887015
ATGAGCAGCTCAGAGGAGGTGTCCTGGATTTCCTGGTTCTGTGGGCTCCGTGGCAATGAATTCTTCTGTGAAGTGGATGAAGACTACATCCAGGACAAAT
TCAATCTCACTGGACTCAACGAGCAGGTGCCTCATTATCGACAAGCCCTAGACATGATCTTGGACCTGGAACCT---GAGGAGCTGGAAGACAACCCCAA
CCAGAGTGACCTGATTGAGCAGGCAGCCGAAATGCTCTATGGATTGATCCACGCCCGCTATATCCTCACCAACCGTGGCATCGCCCAGATGTTGGAAAAG
TACCAGCAGGGAGACTTTGGCTACTGTCCCCGTGTGTACTGTGAGAACCAGCCAATGCTTCCC------CTTTCGGACATCCCAGGCGAGGCCATGGTGA
AGCTCTACTGCCCCAAGTGCATGGACGTGTACACGCCCAAGTCATCGAGGCACCACCACACGGATGGCGCCTACTTCGGCACCGGTTTCCCTCACATGCT
CTTCATGGTGCACCCCGAGTACCGGCCCAAACGGCCTGCCAACCAGTTTGTGCCC---CTCTACGGTTTCAAGATCCATCCAATGGCCTACCAGCTGCAG
CTCCAAGCCGCCAGCAACTTCAAGAGCCCGGTCAAGACAATTCGCTGA


>BGISUSP0000887015
MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEP-EELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEK
YQQGDFGYCPRVYCENQPMLP--LSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVP-LYGFKIHPMAYQLQ
LQAASNFKSPVKTIR*