Sequences
EST Library Info
eep3Foetus 50 days, epidermis
nep1Newborn 115 days, epidermis
ton3Tip of tongue, mucosal membrane
Clusters
Oligos
SNPs

Gene ID ENSG00000111975 (click for geneview)
Transcript ID ENST00000229702(link to ensembl)
Symbol LY6G6C
Localtion Chromosome:6:31794404:31797489:-1 band: 6p21.33
Description Lymphocyte antigen 6 complex locus G6C protein precursor (Protein NG24). [Source:Uniprot/SWISSPROT;Acc:O95867]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<--------------------------------------------------><-----------------------------------------------
-M--K--A--L--M--L--L--T--L--S--V--L--L--C--W--V--S--A--D--I--R--C--H--S--C--Y--K--V--P--V--L--G--C--
ATGAAAGCCCTTATGCTGCTCACCCTGTCTGTTCTGCTCTGCTGGGTCTCAGCTGACATTCGCTGTCACTCCTGCTACAAGGTCCCTGTGCTGGGCTGTG
::::::: :::: ::::::::::::::::::.::::.::::::::::::::   ::::::::::::::::::::::::::::::::.:::::::::::::
ATGAAAGGCCTTCTGCTGCTCACCCTGTCTGCTCTGTTCTGCTGGGTCTCA---GACATTCGCTGTCACTCCTGCTACAAGGTCCCCGTGCTGGGCTGTG
-M--K--G--L--L--L--L--T--L--S--A--L--F--C--W--V--S-----D--I--R--C--H--S--C--Y--K--V--P--V--L--G--C--

--------------------------------------------------------------><------------------------------------
V--D--R--Q--S--C--R--L--E--P--G--Q--Q--C--L--T--T--H--A--Y--L--G--K--M--W--V--F--S--N--L--R--C--G--T
TGGACCGGCAGTCCTGCCGCCTGGAGCCAGGACAGCAATGCCTGACAACACATGCATACCTTGGTAAGATGTGGGTTTTCTCCAATCTGCGCTGTGGCAC
:::::::::::::.::::  :::::.  :::::: ::.::: :.:: ::. :::..::::::   ::::::::::::::::::::.:: :::::::::::
TGGACCGGCAGTCTTGCCTACTGGAAAAAGGACACCAGTGCATAACCACGAATGTGTACCTT---AAGATGTGGGTTTTCTCCAACCTCCGCTGTGGCAC
V--D--R--Q--S--C--L--L--E--K--G--H--Q--C--I--T--T--N--V--Y--L-----K--M--W--V--F--S--N--L--R--C--G--T

----------------------------------------------------------------------------------------------------
--P--E--E--P--C--Q--E--A--F--N--Q--T--N--R--K--L--G--L--T--Y--N--T--T--C--C--N--K--D--N--C--N--S--A-
ACCAGAAGAGCCCTGTCAGGAGGCCTTCAACCAAACCAACCGCAAGCTGGGTCTGACATATAACACCACCTGCTGCAACAAGGACAACTGCAACAGCGCA
:::::::::::::::::.:::.:::::::::::.::::.::.:::::::::.::::: ::::::::::::::::::::::::::::.:::::::::: ::
ACCAGAAGAGCCCTGTCGGGAAGCCTTCAACCAGACCAGCCACAAGCTGGGCCTGACCTATAACACCACCTGCTGCAACAAGGACAGCTGCAACAGCCCA
--P--E--E--P--C--R--E--A--F--N--Q--T--S--H--K--L--G--L--T--Y--N--T--T--C--C--N--K--D--S--C--N--S--P-

----------------------------------------------------------------------------->
-G--P--R--P--T--P--A--L--G--L--V--F--L--T--S--L--A--G--L--G--L--W--L--L--H--*-
GGACCCCGGCCCACTCCAGCCCTGGGCCTTGTCTTCCTTACCTCCTTGGCTGGCCTTGGCCTCTGGCTGCTGCACTGA
:  ::.:::::::::::.::::::: ::: :::.::.:.::::::::::::::::::::::::::::::.::::::::
GCTCCTCGGCCCACTCCGGCCCTGGCCCTGGTCCTCTTCACCTCCTTGGCTGGCCTTGGCCTCTGGCTGTTGCACTGA
-A--P--R--P--T--P--A--L--A--L--V--L--F--T--S--L--A--G--L--G--L--W--L--L--H--*-

Pig Consensus Sequence

>BGISUST0000884282
ATGAAAGGCCTTCTGCTGCTCACCCTGTCTGCTCTGTTCTGCTGGGTCTCA---GACATTCGCTGTCACTCCTGCTACAAGGTCCCCGTGCTGGGCTGTG
TGGACCGGCAGTCTTGCCTACTGGAAAAAGGACACCAGTGCATAACCACGAATGTGTACCTT---AAGATGTGGGTTTTCTCCAACCTCCGCTGTGGCAC
ACCAGAAGAGCCCTGTCGGGAAGCCTTCAACCAGACCAGCCACAAGCTGGGCCTGACCTATAACACCACCTGCTGCAACAAGGACAGCTGCAACAGCCCA
GCTCCTCGGCCCACTCCGGCCCTGGCCCTGGTCCTCTTCACCTCCTTGGCTGGCCTTGGCCTCTGGCTGTTGCACTGA


>BGISUSP0000884282
MKGLLLLTLSALFCWVS-DIRCHSCYKVPVLGCVDRQSCLLEKGHQCITTNVYL-KMWVFSNLRCGTPEEPCREAFNQTSHKLGLTYNTTCCNKDSCNSP
APRPTPALALVLFTSLAGLGLWLLH*