Sequences
EST Library Info
cly1Lymph - RNA from China
cov3Ovary - RNA from China
csp1Spleen - RNA from China
ebs3Foetus 50 days, brain stem
ecc6Foetus 50 days, cortex cerebri
eru3Foetus 50 days, regio umbilicalis
fat3Fatt
jca1Joint capsule
med2Mediastinum
nep2Newborn 115 days, epidermis
nlu2Newborn 115 days, lung
nmm1Newborn 115 days, mucosal membranes
nms1Newborn 115 days, M. semitendinosus
pigcb3Unavailable
plac1Unavailable
ute1Uterus
Clusters
Oligos
SNPs

Gene ID ENSG00000111980 (click for geneview)
Transcript ID ENST00000229707(link to ensembl)
Symbol DDAH2
Localtion Chromosome:6:31802797:31806018:-1 band: 6p21.33
Description NG,NG-dimethylarginine dimethylaminohydrolase 2 (EC 3.5.3.18) (Dimethylargininase 2) (Dimethylarginine dimethylaminohydrolase 2) (DDAHII) (S-phase protein) (G6a protein). [Source:Uniprot/SWISSPROT;Acc:O95865]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--G--T--P--G--E--G--L--G--R--C--S--H--A--L--I--R--G--V--P--E--S--L--A--S--G--E--G--A--G--A--G--L--
ATGGGGACGCCGGGGGAGGGGCTGGGCCGCTGCTCCCATGCCCTGATCCGGGGAGTCCCAGAGAGCCTGGCGTCGGGGGAAGGTGCGGGGGCTGGCCTTC
:::::::::::.:::::::::::::::::::::::::::::::::::::::::.:::::.:::::::::::::::: :::.:::::::::::::::::.:
ATGGGGACGCCAGGGGAGGGGCTGGGCCGCTGCTCCCATGCCCTGATCCGGGGGGTCCCGGAGAGCCTGGCGTCGGTGGAGGGTGCGGGGGCTGGCCTCC
-M--G--T--P--G--E--G--L--G--R--C--S--H--A--L--I--R--G--V--P--E--S--L--A--S--V--E--G--A--G--A--G--L--

----------------------------------------------------------------------------------------------------
P--A--L--D--L--A--K--A--Q--R--E--H--G--V--L--G--G--K--L--R--Q--R--L--G--L--Q--L--L--E--L--P--P--E--E
CCGCTCTGGATCTGGCCAAAGCTCAAAGGGAGCACGGGGTGCTGGGAGGTAAACTGAGGCAACGACTGGGGCTACAGCTGCTAGAACTGCCACCTGAGGA
: ::.:::::.::::::::::::::.:::::::::::::::::::: :::::::::::.::.:::.:::::::.::::::.:::::::::: :::::.::
CGGCCCTGGACCTGGCCAAAGCTCAGAGGGAGCACGGGGTGCTGGGTGGTAAACTGAGACAGCGATTGGGGCTGCAGCTGTTAGAACTGCCTCCTGAAGA
P--A--L--D--L--A--K--A--Q--R--E--H--G--V--L--G--G--K--L--R--Q--R--L--G--L--Q--L--L--E--L--P--P--E--E

------------------------------------------------------------------------------------------------><--
--S--L--P--L--G--P--L--L--G--D--T--A--V--I--Q--G--D--T--A--L--I--T--R--P--W--S--P--A--R--R--P--E--V-
GTCATTGCCGCTGGGACCGCTGCTTGGCGACACGGCCGTGATCCAAGGGGACACGGCCCTAATCACGCGGCCCTGGAGCCCCGCTCGTAGGCCAGAGGTC
:::..:::::::::::::::::::.::.::::: :: ::::::::::::::.::::::::::::::: :.::::::::::::::.::.:::::.::::::
GTCGCTGCCGCTGGGACCGCTGCTCGGTGACACCGCGGTGATCCAAGGGGATACGGCCCTAATCACGAGACCCTGGAGCCCCGCCCGCAGGCCGGAGGTC
--S--L--P--L--G--P--L--L--G--D--T--A--V--I--Q--G--D--T--A--L--I--T--R--P--W--S--P--A--R--R--P--E--V-

------------------------------------------------------------------------------------------------><--
-D--G--V--R--K--A--L--Q--D--L--G--L--R--I--V--E--I--G--D--E--N--A--T--L--D--G--T--D--V--L--F--T--G--
GATGGAGTCCGCAAAGCCCTGCAAGACCTGGGGCTCCGAATTGTGGAAATAGGAGACGAGAACGCGACGCTGGATGGCACTGACGTTCTCTTCACCGGCC
:::::::::::::::::::: ::.:::::::::::::::::::::::.::.::.::::::::::::::.:::::::::::.::.::::::::::::   :
GATGGAGTCCGCAAAGCCCTCCAGGACCTGGGGCTCCGAATTGTGGAGATGGGGGACGAGAACGCGACACTGGATGGCACCGATGTTCTCTTCACC---C
-D--G--V--R--K--A--L--Q--D--L--G--L--R--I--V--E--M--G--D--E--N--A--T--L--D--G--T--D--V--L--F--T-----

----------------------------------------------------------------------><----------------------------
R--E--F--F--V--G--L--S--K--W--T--N--H--R--G--A--E--I--V--A--D--T--F--R--D--F--A--V--S--T--V--P--V--S
GGGAGTTTTTCGTAGGCCTCTCCAAATGGACCAATCACCGAGGAGCTGAGATCGTGGCGGACACGTTCCGGGACTTCGCCGTCTCCACTGTGCCAGTCTC
: :::::::::::::::::.:::::.:::::::::::::: ::::::::::::::::::::::::::::::                             
GCGAGTTTTTCGTAGGCCTTTCCAAGTGGACCAATCACCGTGGAGCTGAGATCGTGGCGGACACGTTCCGG-----------------------------
R--E--F--F--V--G--L--S--K--W--T--N--H--R--G--A--E--I--V--A--D--T--F--R------------------------------

------------------------------------------------------------------------------------------><--------
--G--P--S--H--L--R--G--L--C--G--M--G--G--P--R--T--V--V--A--G--S--S--D--A--A--Q--K--A--V--R--A--M--A-
GGGTCCCTCCCACCTGCGCGGTCTCTGCGGCATGGGGGGACCTCGCACTGTTGTGGCAGGCAGCAGCGACGCTGCCCAAAAGGCTGTCCGGGCAATGGCA
                                                                                           :::::::::
-------------------------------------------------------------------------------------------GCAATGGCA
--------------------------------------------------------------------------------------------A--M--A-

----------------------------------------------------------------------------------------------------
-V--L--T--D--H--P--Y--A--S--L--T--L--P--D--D--A--A--A--D--C--L--F--L--R--P--G--L--P--G--V--P--P--F--
GTGCTGACAGATCACCCATATGCCTCCCTGACCCTCCCAGATGACGCAGCTGCTGACTGTCTCTTTCTTCGTCCTGGGTTGCCTGGTGTGCCCCCTTTCC
:::.::::.:::::.:: :::::::::::::::::::::::::::::::: ::::::::::::::::: :::::::::.:::: :: :::::::: ::::
GTGTTGACGGATCATCCCTATGCCTCCCTGACCCTCCCAGATGACGCAGCGGCTGACTGTCTCTTTCTGCGTCCTGGGCTGCCGGGAGTGCCCCCGTTCC
-V--L--T--D--H--P--Y--A--S--L--T--L--P--D--D--A--A--A--D--C--L--F--L--R--P--G--L--P--G--V--P--P--F--

----------------------------------------><----------------------------------------------------------
L--L--H--R--G--G--G--D--L--P--N--S--Q--E--A--L--Q--K--L--S--D--V--T--L--V--P--V--S--C--S--E--L--E--K
TCCTGCACCGTGGAGGTGGGGATCTGCCCAACAGCCAGGAGGCACTGCAGAAGCTCTCTGATGTCACCCTGGTACCTGTGTCCTGCTCAGAACTGGAGAA
:::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::.:::::::::::
TCCTGCACCGTGGAGGTGGGGATCTACCCAACAGCCAGGAGGCACTGCAGAAGCTCTCTGACGTCACCCTGGTACCTGTGTCCTGCTCGGAACTGGAGAA
L--L--H--R--G--G--G--D--L--P--N--S--Q--E--A--L--Q--K--L--S--D--V--T--L--V--P--V--S--C--S--E--L--E--K

--------------------------------------------------------->
--A--G--A--G--L--S--S--L--C--L--V--L--S--T--R--P--H--S--*-
GGCTGGCGCCGGGCTCAGCTCCCTCTGCTTGGTGCTCAGCACACGCCCCCACAGCTGA
::: :::::.::::::::::::::::::.:::::::::::::::::::::::::::::
GGCGGGCGCTGGGCTCAGCTCCCTCTGCCTGGTGCTCAGCACACGCCCCCACAGCTGA
--A--G--A--G--L--S--S--L--C--L--V--L--S--T--R--P--H--S--*-

Pig Consensus Sequence

>BGISUST0000895305
ATGGGGACGCCAGGGGAGGGGCTGGGCCGCTGCTCCCATGCCCTGATCCGGGGGGTCCCGGAGAGCCTGGCGTCGGTGGAGGGTGCGGGGGCTGGCCTCC
CGGCCCTGGACCTGGCCAAAGCTCAGAGGGAGCACGGGGTGCTGGGTGGTAAACTGAGACAGCGATTGGGGCTGCAGCTGTTAGAACTGCCTCCTGAAGA
GTCGCTGCCGCTGGGACCGCTGCTCGGTGACACCGCGGTGATCCAAGGGGATACGGCCCTAATCACGAGACCCTGGAGCCCCGCCCGCAGGCCGGAGGTC
GATGGAGTCCGCAAAGCCCTCCAGGACCTGGGGCTCCGAATTGTGGAGATGGGGGACGAGAACGCGACACTGGATGGCACCGATGTTCTCTTCACC---C
GCGAGTTTTTCGTAGGCCTTTCCAAGTGGACCAATCACCGTGGAGCTGAGATCGTGGCGGACACGTTCCGG-----------------------------
-------------------------------------------------------------------------------------------GCAATGGCA
GTGTTGACGGATCATCCCTATGCCTCCCTGACCCTCCCAGATGACGCAGCGGCTGACTGTCTCTTTCTGCGTCCTGGGCTGCCGGGAGTGCCCCCGTTCC
TCCTGCACCGTGGAGGTGGGGATCTACCCAACAGCCAGGAGGCACTGCAGAAGCTCTCTGACGTCACCCTGGTACCTGTGTCCTGCTCGGAACTGGAGAA
GGCGGGCGCTGGGCTCAGCTCCCTCTGCCTGGTGCTCAGCACACGCCCCCACAGCTGA


>BGISUSP0000895305
MGTPGEGLGRCSHALIRGVPESLASVEGAGAGLPALDLAKAQREHGVLGGKLRQRLGLQLLELPPEESLPLGPLLGDTAVIQGDTALITRPWSPARRPEV
DGVRKALQDLGLRIVEMGDENATLDGTDVLFT-REFFVGLSKWTNHRGAEIVADTFR----------------------------------------AMA
VLTDHPYASLTLPDDAAADCLFLRPGLPGVPPFLLHRGGGDLPNSQEALQKLSDVTLVPVSCSELEKAGAGLSSLCLVLSTRPHS*