Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000111985 (click for geneview)
Transcript ID ENST00000229712(link to ensembl)
Symbol NP_079534.1
Localtion Chromosome:6:31841495:31853028:-1 band: 6p21.33
Description NG37 protein [Source:RefSeq_peptide;Acc:NP_079534]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--L--P--T--E--V--P--Q--S--H--P--G--P--S--A--L--L--L--L--Q--L--L--L--P--P--T--S--A--F--F--P--N--I--
ATGCTCCCCACGGAGGTCCCCCAATCCCACCCGGGCCCCTCAGCGTTGCTTCTGCTGCAGCTGTTGCTGCCCCCCACATCTGCCTTCTTCCCCAACATCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
W--S--L--L--A--A--P--G--S--I--T--H--Q--D--L--T--E--E--A--A--L--N--V--T--L--Q--L--F--L--E--Q--P--P--P
GGAGCCTGCTGGCTGCCCCTGGCTCCATCACCCACCAAGACCTAACTGAGGAGGCAGCGCTCAACGTCACCCTGCAGCTCTTCCTGGAGCAGCCACCCCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------------><-----------------------------------------------------------------
--G--R--P--P--L--R--L--E--D--F--L--G--R--T--L--L--A--D--D--L--F--A--A--Y--F--G--P--G-----S--S--R--R-
AGGCCGCCCCCCTCTTCGTCTTGAGGACTTCCTGGGTCGAACACTCCTTGCTGATGACCTCTTTGCCGCCTACTTTGGACCTGGT---TCTTCTCGGCGG
                                  ::.:: :: ::::::::.::.:::::::::::.::::::::::: :::::    .:.::.::::: 
----------------------------------GGCCGCACCCTCCTTGCCGACGACCTCTTTGCTGCCTACTTTGGCCCTGGGTTTCCCTCCCGGCGC
-----------------------------------G--R--T--L--L--A--D--D--L--F--A--A--Y--F--G--P--G--F--P--S--R--R-

----------------------------------------------------------------------------------------------------
-F--R--A--A--L--G--E--V--S--R--A--N--A--A--Q--D--F--L--P--T--S--R--N--D--P--D--L--H--F--D--A--E--R--
TTCCGAGCAGCCTTAGGTGAGGTGTCTCGTGCCAATGCAGCCCAGGACTTCCTGCCAACTTCCAGGAATGACCCCGACCTGCACTTTGATGCTGAGCGAC
:::::.:::::::::::.:::::::::::::::::::: :::::::::::::::::.:::::::::::.::::::::::::::::::::.:::::::: :
TTCCGGGCAGCCTTAGGCGAGGTGTCTCGTGCCAATGCCGCCCAGGACTTCCTGCCGACTTCCAGGAACGACCCCGACCTGCACTTTGACGCTGAGCGCC
-F--R--A--A--L--G--E--V--S--R--A--N--A--A--Q--D--F--L--P--T--S--R--N--D--P--D--L--H--F--D--A--E--R--

----------------------------------------------------------------------------------------------------
L--G--Q--G--R--A--R--L--V--G--A--L--R--E--T--V--V--A--A--R--A--L--D--H--T--L--A--R--Q--R--L--G--A--A
TGGGTCAGGGACGCGCGCGCCTGGTAGGGGCTCTGCGGGAGACCGTGGTGGCAGCCAGGGCCCTTGACCACACCCTGGCTCGCCAGCGCCTCGGGGCTGC
::::.:::::.:::.:.:::.::::.::::::::::::::::::::::::::::::.:.::::: ::::::::::::::.:::::::::::::::::.::
TGGGCCAGGGGCGCACACGCTTGGTGGGGGCTCTGCGGGAGACCGTGGTGGCAGCCGGAGCCCTGGACCACACCCTGGCCCGCCAGCGCCTCGGGGCCGC
L--G--Q--G--R--T--R--L--V--G--A--L--R--E--T--V--V--A--A--G--A--L--D--H--T--L--A--R--Q--R--L--G--A--A

---------------><-----------------------------------------------------------------------------------
--L--H--A--L--Q--D--F--Y--S--H--S--N--W--V--E--L--G--E--Q--Q--P--H--P--H--L--L--W--P--R--Q--E--L--Q-
ACTTCATGCCCTGCAGGATTTCTACAGTCATAGCAACTGGGTGGAGCTGGGCGAGCAGCAGCCACACCCTCACCTCCTCTGGCCAAGGCAGGAGCTCCAG
 :::::::::.:::::                                                                                    
TCTTCATGCCTTGCAG------------------------------------------------------------------------------------
--L--H--A--L--Q-------------------------------------------------------------------------------------

------------><--------------------------------------------------------------------------------------
-N--L--A--Q--V--A--D--P--T--C--S--D--C--E--E--L--S--C--P--R--N--W--L--G--F--T--L--L--T--S--G--Y--F--
AACCTGGCACAAGTGGCCGATCCTACCTGCTCCGATTGCGAGGAGTTGAGCTGCCCCAGGAATTGGCTGGGCTTCACACTCCTCACCTCTGGCTACTTTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------><---------------------------------------------------------------------------
G--T--H--P--P--K--P--P--G--K--C--S--H--G--G--H--F--D--R--S--S--S--Q--P--P--R--G--G--I--N--K--D--S--T
GAACTCATCCCCCGAAACCTCCAGGGAAATGTAGCCACGGGGGCCATTTTGACCGGAGCAGCTCCCAGCCACCGAGGGGAGGCATCAACAAGGACAGCAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--S--P--G--F--S--P--H--H--M--L--H--L--Q--A--A--K--L--A--L--L--A--S--I--Q--A--F--S--L--L--R--S--R--L-
ATCCCCAGGCTTCTCCCCTCACCACATGCTGCACCTCCAGGCTGCAAAACTGGCCCTTCTAGCCTCCATCCAGGCCTTCAGCCTTCTGCGAAGCCGCCTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------><-------------------------------------------------------------------------------
-G--D--R--D--F--S--R--L--L--D--I--T--P--A--S--S--L--S--F--V--L--D--T--T--G--S--M--G--E--E--I--N--A--
GGAGACAGGGATTTCTCCAGGCTGCTGGACATCACCCCAGCCTCCAGCCTGAGCTTTGTCCTGGACACCACGGGCAGCATGGGTGAGGAGATCAACGCTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------------------------------------------------------------------><---------
A--K--I--Q--A--R--H--L--V--E--Q--R--R--G--S--P--M--E--P--V--H--Y--V--L--V--P--F--H--D--P--G--F--G--P
CCAAAATCCAGGCTCGCCACCTTGTGGAGCAGCGGAGAGGCAGCCCCATGGAGCCTGTCCACTATGTCCTGGTGCCTTTTCATGACCCAGGGTTCGGCCC
                                                                                            ::.:::::
--------------------------------------------------------------------------------------------TTTGGCCC
---------------------------------------------------------------------------------------------F--G--P

----------------------------------------------------------------------------------------------------
--V--F--T--T--S--D--P--D--S--F--W--Q--Q--L--N--E--I--H--A--L--G--G--G--D--E--P--E--M--C--L--S--A--L-
TGTCTTTACAACCAGTGACCCTGACAGCTTCTGGCAACAGCTTAATGAGATCCATGCCTTGGGGGGTGGAGACGAGCCTGAGATGTGCCTGTCAGCCCTG
::: ::::. :::::::::::::::::::::::::::::.::.:::::::: ::.::::::::.::::::::::::::.:::::::::.:::::::::::
TGTGTTTATCACCAGTGACCCTGACAGCTTCTGGCAACAACTCAATGAGATACACGCCTTGGGAGGTGGAGACGAGCCCGAGATGTGCTTGTCAGCCCTG
--V--F--I--T--S--D--P--D--S--F--W--Q--Q--L--N--E--I--H--A--L--G--G--G--D--E--P--E--M--C--L--S--A--L-

--><------------------------------------------------------------------------------------------------
-Q--L--A--L--L--H--T--P--P--L--S--D--I--F--V--F--T--D--A--S--P--K--D--A--F--L--T--N--Q--V--E--S--L--
CAGCTGGCCCTGCTGCACACACCTCCACTCTCAGATATCTTTGTCTTCACGGATGCCTCCCCCAAGGATGCCTTTCTCACCAACCAGGTGGAATCCCTGA
 :::::::: :::: :::::::::::.::::::::.:::::.:::::::: ::.::::::::::::::::::: :::::::::.:.::::::::::::::
GAGCTGGCCATGCTCCACACACCTCCGCTCTCAGACATCTTCGTCTTCACTGACGCCTCCCCCAAGGATGCCTATCTCACCAATCGGGTGGAATCCCTGA
-E--L--A--M--L--H--T--P--P--L--S--D--I--F--V--F--T--D--A--S--P--K--D--A--Y--L--T--N--R--V--E--S--L--

-------------------><-------------------------------------------------------------------------------
T--Q--E--R--R--C--R--V--T--F--L--V--T--E--D--T--S--R--V--Q--G--R--A--R--R--E--I--L--S--P--L--R--F--E
CTCAGGAGCGGCGCTGCCGGGTAACATTCCTGGTGACTGAAGATACATCAAGGGTTCAGGGTCGAGCTCGGCGTGAGATCTTGTCCCCTCTGCGTTTTGA
:::.:::::::::.:::                                                               ::::::::::::::::::::
CTCGGGAGCGGCGTTGC---------------------------------------------------------------TTGTCCCCTCTGCGTTTTGA
T--R--E--R--R--C-----------------------------------------------------------------L--S--P--L--R--F--E

----------------------------------------------------------------------------------------------------
--P--Y--K--A--V--A--L--A--S--G--G--E-----V--I--F--T--K--D--Q--H--I--R--D--V--A--A--I--V--G--E--S--M-
GCCATACAAAGCAGTGGCCCTGGCCTCAGGAGGAGAG---GTGATCTTCACCAAAGACCAGCACATTCGAGACGTGGCAGCCATTGTTGGGGAGAGCATG
::::::..::::.::::::::::::::.:: :::.:.   :::::::::::::::.:::::.::::::..:..:::::::::::::::::::: :::::.
GCCATATGAAGCGGTGGCCCTGGCCTCGGGTGGAAAAA--GTGATCTTCACCAAAAACCAGTACATTCAGGGTGTGGCAGCCATTGTTGGGGACAGCATA
--P--Y--E--A--V--A--L--A--S--G--G--K--\--V--I--F--T--K--N--Q--Y--I--Q--G--V--A--A--I--V--G--D--S--I-

--------><------------------------------------------------------------------------------------------
-A--A--L--V--T--L--P--L--D--P--P--V--V--V--P--G--Q--P--L--V--F--S--V--D--G--L--L--Q--K--I--T--V--R--
GCTGCCCTGGTGACTCTTCCCCTGGACCCTCCTGTTGTGGTGCCTGGGCAGCCACTTGTGTTCAGCGTGGATGGGCTGCTCCAGAAGATCACAGTCCGGA
:::: :::::::::.::::::::::: ::::::.::::::::::::.: .:::::: :::::::..:::::::::::::::::::.:.::::::::::::
GCTGACCTGGTGACCCTTCCCCTGGAGCCTCCTATTGTGGTGCCTGAGAGGCCACTGGTGTTCAATGTGGATGGGCTGCTCCAGAGGGTCACAGTCCGGA
-A--D--L--V--T--L--P--L--E--P--P--I--V--V--P--E--R--P--L--V--F--N--V--D--G--L--L--Q--R--V--T--V--R--

-----------------------------------------><---------------------------------------------------------
I--H--G--D--I--S--S--F--W--I--K--N--P--A--G--V--S--Q--G--Q--E--E--G--G--G--P--L--G--H--T--R--R--F--G
TCCACGGAGACATCAGCAGCTTCTGGATCAAGAACCCTGCAGGGGTCTCCCAGGGCCAGGAGGAAGGCGGGGGTCCTCTAGGTCACACTCGCCGCTTTGG
::::::: :: .::::::::::::::::::..:::::::::   :::::::::::.::::: :::::.:.::: :::::::::::::::::::.::::::
TCCACGGCGAGGTCAGCAGCTTCTGGATCAGAAACCCTGCA---GTCTCCCAGGGTCAGGACGAAGGTGAGGGGCCTCTAGGTCACACTCGCCACTTTGG
I--H--G--E--V--S--S--F--W--I--R--N--P--A-----V--S--Q--G--Q--D--E--G--E--G--P--L--G--H--T--R--H--F--G

----------------------------------------------------------------------------------------------><----
--Q--F--W--M--V--T--M--D--D--P--P--Q--T--G--T--W--E--I--Q--V--T--A--E--D--T--P--G--V--R--V--Q--A--Q-
GCAGTTCTGGATGGTGACCATGGATGACCCTCCACAGACAGGAACCTGGGAGATCCAGGTCACAGCTGAGGACACCCCTGGGGTGAGAGTGCAAGCCCAG
::::::::::::.:::::::::.:::::::::..::::::::::::::::::::::::::::::::..: :.::::::: . ::.:::::::.:      
GCAGTTCTGGATAGTGACCATGAATGACCCTCTGCAGACAGGAACCTGGGAGATCCAGGTCACAGCCAACGGCACCCCTCATGTAAGAGTGCGA------
--Q--F--W--I--V--T--M--N--D--P--L--Q--T--G--T--W--E--I--Q--V--T--A--N--G--T--P--H--V--R--V--R-------

---------------------------------------------------------------------------------------><-----------
-T--S--L--D--F--L--F--H--F--G--I--P--M--E--D--G--P--H--P--G--L--Y--P--L--T--Q--P--V--A--G--L--Q--T--
ACCTCCCTGGACTTCCTCTTCCACTTTGGGATCCCCATGGAGGATGGACCCCACCCTGGCCTCTACCCCCTGACTCAGCCAGTTGCAGGTCTTCAGACCC
                                                                                             ::::::.
---------------------------------------------------------------------------------------------CAGACCT
----------------------------------------------------------------------------------------------Q--T--

----------------------------------------------------------------------------------------------------
Q--L--L--V--E--V--T--G--L--G--S--R--A--N--P--G--D--P--Q--P--H--F--S--H--V--I--L--R--G--V--P--E--G--A
AGCTGCTGGTAGAAGTGACAGGGTTGGGTTCCAGAGCCAATCCTGGGGATCCTCAGCCGCATTTCTCCCACGTCATCCTTCGAGGGGTCCCAGAGGGTGC
:::::::::::::::::::::::.: ::::: ::::  ::.:::::.:::::::  ::::.:::::: ::::::.:::::::::::::::.. :::::: 
AGCTGCTGGTAGAAGTGACAGGGCTTGGTTCGAGAGGAAACCCTGGAGATCCTCTCCCGCGTTTCTCGCACGTCGTCCTTCGAGGGGTCCTGCAGGGTGA
*--L--L--V--E--V--T--G--L--G--S--R--G--N--P--G--D--P--L--P--R--F--S--H--V--V--L--R--G--V--L--Q--G--E

----------------------------------------------------------------------------------------------------
--E--L--G--Q--V--P--L--E--P--V--G--P--P--E--R--G--L--L--A--A--S--L--S--P--T--L--L--S--T--P--R--P--F-
CGAACTAGGCCAGGTGCCCTTGGAGCCCGTGGGACCTCCGGAGCGAGGTCTCCTCGCAGCCTCGCTGTCGCCCACGCTGCTGTCCACCCCTAGACCCTTC
 ::.::.::.:.::::::.:::::::: .:::::::.: :::.::::::::::::.: ::.:::::..:.:::::::: ::: :::::.: .::::::::
GGAGCTGGGTCGGGTGCCTTTGGAGCCGATGGGACCCCAGGAACGAGGTCTCCTCACTGCTTCGCTACCACCCACGCTCCTGGCCACCTCGGGACCCTTC
--E--L--G--R--V--P--L--E--P--M--G--P--Q--E--R--G--L--L--T--A--S--L--P--P--T--L--L--A--T--S--G--P--F-

-----------------------------------------------------------------------------------------><---------
-S--L--E--L--I--G--Q--D--A--A--G--R--R--L--H--R--A--A--P--Q--P--S--T--V--V--P--V--L--L--E--L--S--G--
TCCCTGGAGCTGATTGGCCAGGACGCAGCGGGGCGGCGCCTGCACAGGGCTGCCCCTCAGCCTAGCACTGTAGTCCCTGTCCTTCTGGAGCTTAGTGGCC
::.::::::::::::::::::::.: :::.::::.: :::::::: :::: :::::.:::::. :..:::::::.::::::.::::::::::.:::::.:
TCTCTGGAGCTGATTGGCCAGGATGGAGCAGGGCAGGGCCTGCACCGGGCAGCCCCCCAGCCCTGTGCTGTAGTTCCTGTCTTTCTGGAGCTCAGTGGTC
-S--L--E--L--I--G--Q--D--G--A--G--Q--G--L--H--R--A--A--P--Q--P--C--A--V--V--P--V--F--L--E--L--S--G--

----------------------------------------------------------------------------------------------------
P--S--G--F--L--A--P--G--S--K--V--P--L--S--L--R--I--A--S--F--S--G--P--Q--D--L--D--L--R--T--F--V--N--P
CCTCGGGTTTCTTGGCCCCGGGCAGCAAAGTCCCGCTCAGTCTCCGCATCGCCAGCTTCTCGGGCCCTCAGGATCTTGACCTTAGGACTTTCGTCAACCC
::.::::::::.:::: ::::::: :::.:.:::.::::  ::.::::::::::::::::::::::::::::::::.::.:::::::: :.:::::::::
CCCCGGGTTTCCTGGCGCCGGGCACCAAGGCCCCACTCACGCTTCGCATCGCCAGCTTCTCGGGCCCTCAGGATCTCGATCTTAGGACATCCGTCAACCC
P--P--G--F--L--A--P--G--T--K--A--P--L--T--L--R--I--A--S--F--S--G--P--Q--D--L--D--L--R--T--S--V--N--P

-----------------------------><---------------------------------------------------------------------
--S--F--S--L--T--S--N--L--S--R--A--H--L--E--L--N--E--S--A--W--G--R--L--W--L--E--V--P--D--S--A--A--P-
CAGCTTCTCCCTCACCTCCAACCTCTCCAGGGCTCACCTGGAACTGAATGAGTCGGCCTGGGGCCGCCTGTGGCTGGAGGTCCCAGATTCAGCGGCCCCG
::::::: :.:::: ::::::: :::::   :.:::::::::::.:::::::::::::::::: :..::::::::::::::::::::.:: :: .:::::
CAGCTTCGCTCTCAGCTCCAACATCTCC---GTTCACCTGGAACCGAATGAGTCGGCCTGGGGGCATCTGTGGCTGGAGGTCCCAGACTCTGCCACCCCG
--S--F--A--L--S--S--N--I--S-----V--H--L--E--P--N--E--S--A--W--G--H--L--W--L--E--V--P--D--S--A--T--P-

----------------------------------------------------------------------------------------------------
-D--S--V--V--M--V--T--V--T--A--G--G--R-----E--A--N--P--V--P--P--T--H--A--F--L--R--L--L--V--S--A--P--
GATTCCGTGGTGATGGTGACTGTGACTGCAGGGGGACGA---GAAGCCAACCCAGTACCCCCGACTCATGCTTTCCTCCGGCTCCTGGTATCGGCCCCAG
::.:::.::::::::::::::::::: ::.. :. : .    :::::::.: :::.:::::::::.:::::.:::::::::::::::::...:::::: :
GACTCCATGGTGATGGTGACTGTGACGGCGACGACAGATGGAGAAGCCAGCACAGCACCCCCGACCCATGCCTTCCTCCGGCTCCTGGTGCTGGCCCCCG
-D--S--M--V--M--V--T--V--T--A--T--T--D--G--E--A--S--T--A--P--P--T--H--A--F--L--R--L--L--V--L--A--P--

-----------------------------------><------------------------------>
A--P--Q--V--R--N--H--Y--F--P--S--Q--G--P--A--H--H--P--Y--R--L--I--*-
CCCCGCAGGTGAGGAACCACTACTTTCCATCACAGGGACCGGCACACCACCCCTACCGGCTCATCTGA
:.::.::::::::: . : :.::::.                                          
CTCCACAGGTGAGGTGGCCCCACTTC------------------------------------------
A--P--Q--V--R--W--P--H--F-------------------------------------------

Pig Consensus Sequence

>BGISUST0000885146
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------GGCCGCACCCTCCTTGCCGACGACCTCTTTGCTGCCTACTTTGGCCCTGGGTTTCCCTCCCGGCGC
TTCCGGGCAGCCTTAGGCGAGGTGTCTCGTGCCAATGCCGCCCAGGACTTCCTGCCGACTTCCAGGAACGACCCCGACCTGCACTTTGACGCTGAGCGCC
TGGGCCAGGGGCGCACACGCTTGGTGGGGGCTCTGCGGGAGACCGTGGTGGCAGCCGGAGCCCTGGACCACACCCTGGCCCGCCAGCGCCTCGGGGCCGC
TCTTCATGCCTTG---------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-----------------------------------------------------------------------------------------TTTGGCCCTGT
GTTTATCACCAGTGACCCTGACAGCTTCTGGCAACAACTCAATGAGATACACGCCTTGGGAGGTGGAGACGAGCCCGAGATGTGCTTGTCAGCCCTGGAG
CTGGCCATGCTCCACACACCTCCGCTCTCAGACATCTTCGTCTTCACTGACGCCTCCCCCAAGGATGCCTATCTCACCAATCGGGTGGAATCCCTGACTC
GGGAGCGGCGTTGC---------------------------------------------------------------TTGTCCCCTCTGCGTTTTGAGCC
ATATGAAGCGGTGGCCCTGGCCTCGGGTGGAAAagTGATCTTCACCAAAAACCAGTACATTCAGGGTGTGGCAGCCATTGTTGGGGACAGCATAGCTGAC
CTGGTGACCCTTCCCCTGGAGCCTCCTATTGTGGTGCCTGAGAGGCCACTGGTGTTCAATGTGGATGGGCTGCTCCAGAGGGTCACAGTCCGGATCCACG
GCGAGGTCAGCAGCTTCTGGATCAGAAACCCTGCA---GTCTCCCAGGGTCAGGACGAAGGTGAGGGGCCTCTAGGTCACACTCGCCACTTTGGGCAGTT
CTGGATAGTGACCATGAATGACCCTCTGCAGACAGGAACCTGGGAGATCCAGGTCACAGCCAACGGCACCCCTCATGTAAGAGTGCGA------------
---------------------------------------------------------------------------------------CAGACCTAGCTGC
TGGTAGAAGTGACAGGGCTTGGTTCGAGAGGAAACCCTGGAGATCCTCTCCCGCGTTTCTCGCACGTCGTCCTTCGAGGGGTCCTGCAGGGTGAGGAGCT
GGGTCGGGTGCCTTTGGAGCCGATGGGACCCCAGGAACGAGGTCTCCTCACTGCTTCGCTACCACCCACGCTCCTGGCCACCTCGGGACCCTTCTCTCTG
GAGCTGATTGGCCAGGATGGAGCAGGGCAGGGCCTGCACCGGGCAGCCCCCCAGCCCTGTGCTGTAGTTCCTGTCTTTCTGGAGCTCAGTGGTCCCCCGG
GTTTCCTGGCGCCGGGCACCAAGGCCCCACTCACGCTTCGCATCGCCAGCTTCTCGGGCCCTCAGGATCTCGATCTTAGGACATCCGTCAACCCCAGCTT
CGCTCTCAGCTCCAACATCTCC---GTTCACCTGGAACCGAATGAGTCGGCCTGGGGGCATCTGTGGCTGGAGGTCCCAGACTCTGCCACCCCGGACTCC
ATGGTGATGGTGACTGTGACGGCGACGACAGATGGAGAAGCCAGCACAGCACCCCCGACCCATGCCTTCCTCCGGCTCCTGGTGCTGGCCCCCGCTCCAC
AGGTGAGGTGGCCCCAC------------------------------------------


>BGISUSP0000885146
------------------------------------------------------------------------------GRTLLADDLFAAYFGPGFPSRR
FRAALGEVSRANAAQDFLPTSRNDPDLHFDAERLGQGRTRLVGALRETVVAAGALDHTLARQRLGAALHAL-----------------------------
----------------------------------------------------------------------------------------------------
---------------------------------------------------------------FGPVFITSDPDSFWQQLNEIHALGGGDEPEMCLSALE
LAMLHTPPLSDIFVFTDASPKDAYLTNRVESLTRERRC---------------------LSPLRFEPYEAVALASGGKVIFTKNQYIQGVAAIVGDSIAD
LVTLPLEPPIVVPERPLVFNVDGLLQRVTVRIHGEVSSFWIRNPA-VSQGQDEGEGPLGHTRHFGQFWIVTMNDPLQTGTWEIQVTANGTPHVRVR----
-----------------------------QT*LLVEVTGLGSRGNPGDPLPRFSHVVLRGVLQGEELGRVPLEPMGPQERGLLTASLPPTLLATSGPFSL
ELIGQDGAGQGLHRAAPQPCAVVPVFLELSGPPGFLAPGTKAPLTLRIASFSGPQDLDLRTSVNPSFALSSNIS-VHLEPNESAWGHLWLEVPDSATPDS
MVMVTVTATTDGEASTAPPTHAFLRLLVLAPAPQVRWPH--------------