Sequences
EST Library Info
cad1Unavailable
cly1Lymph - RNA from China
Clusters
Oligos
SNPs

Gene ID ENSG00000111987 (click for geneview)
Transcript ID ENST00000229715(link to ensembl)
Symbol LSM2
Localtion Chromosome:6:31873155:31882731:-1 band: 6p21.33
Description U6 snRNA-associated Sm-like protein LSm2 (SnRNP core Sm-like protein Sm-x5) (G7b protein) (Small nuclear ribonuclear protein D homolog). [Source:Uniprot/SWISSPROT;Acc:Q9Y333]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-><------------------------------------------------------------------><----------------------------
-M--L--F--Y--S--F--F--K--S--L--V--G--K--D--V--V--V--E--L--K--N--D--L--S--I--C--G--T--L--H--S--V--D--
ATGCTCTTCTATTCTTTTTTCAAGTCCCTTGTGGGCAAGGATGTGGTCGTGGAACTAAAGAATGACCTGAGCATCTGTGGAACCCTCCATTCTGTGGATC
   :::::::::::.::::::::::::::::::::::::::::::::::::::::: ::::::::::::   ::::::::::::::::::::::::::::
---CTCTTCTATTCCTTTTTCAAGTCCCTTGTGGGCAAGGATGTGGTCGTGGAACTCAAGAATGACCTG---ATCTGTGGAACCCTCCATTCTGTGGATC
----L--F--Y--S--F--F--K--S--L--V--G--K--D--V--V--V--E--L--K--N--D--L-----I--C--G--T--L--H--S--V--D--

-><-------------------------------------------------------------><----------------------------------
Q--Y--L--N--I--K--L--T--D--I--S--V--T--D--P--E--K--Y--P--H--M--L--S--V--K--N--C--F--I--R--G--S--V--V
AGTATCTCAACATCAAACTAACTGACATCAGTGTCACAGACCCTGAGAAATACCCTCACATGTTATCAGTGAAGAACTGCTTCATTCGGGGCTCAGTGGT
:::::::::::::::: ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::.:::::::::::
AGTATCTCAACATCAA-CTAACTGACATCAGTGTCACAGACCCTGAGAAATACCCTCACATGTTATCAGTGAAGAACTGCTTCATCCGAGGCTCAGTGGT
Q--Y--L--N--I--K--L--T--D--I--S--V--T--D--P--E--K--Y--P--H--M--L--S--V--K--N--C--F--I--R--G--S--V--V

----------------------------------------------------------------------------------------
--R--Y--V--Q--L--P--A--D--E--V--D--T--Q--L--L--Q--D--A--A--R--K--E--A--L--Q--Q--K--Q--*-
CCGATACGTGCAGCTGCCAGCAGATGAGGTCGACACACAGTTGCTACAGGATGCGGCAAGGAAGGAAGCCCTGCAGCAGAAACAGTGA
.:: ::.::::::.::::::::::::::::.::::::::::::::::::::.::.::::::::.::.::::::::.:::::.::::::
TCGCTATGTGCAGTTGCCAGCAGATGAGGTTGACACACAGTTGCTACAGGACGCAGCAAGGAAAGAGGCCCTGCAACAGAAGCAGTGA
--R--Y--V--Q--L--P--A--D--E--V--D--T--Q--L--L--Q--D--A--A--R--K--E--A--L--Q--Q--K--Q--*-

Pig Consensus Sequence

>BGISUST0000896958
---CTCTTCTATTCCTTTTTCAAGTCCCTTGTGGGCAAGGATGTGGTCGTGGAACTCAAGAATGACCTG---ATCTGTGGAACCCTCCATTCTGTGGATC
AGTATCTCAACATccTAACTGACATCAGTGTCACAGACCCTGAGAAATACCCTCACATGTTATCAGTGAAGAACTGCTTCATCCGAGGCTCAGTGGTTCG
CTATGTGCAGTTGCCAGCAGATGAGGTTGACACACAGTTGCTACAGGACGCAGCAAGGAAAGAGGCCCTGCAACAGAAGCAGTGA


>BGISUSP0000896958
-LFYSFFKSLVGKDVVVELKNDL-ICGTLHSVDQYLNILTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ*