Sequences
EST Library Info
cje12Jejunum - RNA from China
cki2Kidney - RNA from China
cmu1Rhinal mucous membrane - RNA from China
cov1Ovary - RNA from China
cst5Stomach - RNA from China
eje1Foetus 50 days, jejunum
jej9Small intestine, jejunum
nmm4Newborn 115 days, mucosal membranes
pgl1Pituitary gland
pigca1Unavailable
sto3Stomach
tra1Trachea
ute2Uterus
Clusters
Oligos
SNPs

Gene ID ENSG00000112000 (click for geneview)
Transcript ID ENST00000229729(link to ensembl)
Symbol NP_079533.1
Localtion Chromosome:6:31938954:31954753:-1 band: 6p21.33
Description NG22 protein [Source:RefSeq_peptide;Acc:NP_079533]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<--------------------------------------><-----------------------------------------------><----------
-M--G--G--K--Q--R--D--E--D--D--E--A--Y--G--K--P--V--K--Y--D--P--S--F--R--G--P--I--K--N--R--S--C--T--
ATGGGGGGAAAGCAGCGGGACGAGGATGACGAGGCCTACGGGAAGCCAGTCAAATACGACCCCTCCTTTCGAGGCCCCATCAAGAACAGAAGCTGCACAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------------------------><------------------------------------
D--V--I--C--C--V--L--F--L--L--F--I--L--G--Y--I--V--V--G--I--V--A--W--L--Y--G--D--P--R--Q--V--L--Y--P
ATGTCATCTGCTGCGTCCTCTTCCTGCTCTTCATTCTAGGTTACATCGTGGTGGGGATTGTGGCCTGGTTGTATGGAGACCCCCGGCAAGTCCTCTACCC
                                                                 ::: : :::::::::::::.:::::::::::::::
-----------------------------------------------------------------TGGGTCTATGGAGACCCCCAGCAAGTCCTCTACCC
------------------------------------------------------------------W--V--Y--G--D--P--Q--Q--V--L--Y--P

-----------------------------------------><---------------------------------------------------------
--R--N--S--T--G--A--Y--C--G--M--G--E--N--K--D--K--P--Y--L--L--Y--F--N--I--F--S--C--I--L--S--S--N--I-
CAGGAACTCTACTGGGGCCTACTGTGGCATGGGGGAGAACAAAGATAAGCCGTATCTCCTGTACTTCAACATCTTCAGCTGCATCCTGTCCAGCAACATC
: :::::::: ::::::::::.::.:: :: :::::.:::   :::::.:: ::::::::::::::::::::::::::::::.::::. ::: :::::::
CCGGAACTCTTCTGGGGCCTATTGCGGGATCGGGGAAAAC---GATAAACCCTATCTCCTGTACTTCAACATCTTCAGCTGCGTCCTAACCACCAACATC
--R--N--S--S--G--A--Y--C--G--I--G--E--N-----D--K--P--Y--L--L--Y--F--N--I--F--S--C--V--L--T--T--N--I-

-----------------------------------------><---------------------------------------------------------
-I--S--V--A--E--N--G--L--Q--C--P--T--P--Q--V--C--V--S--S--C--P--E--D--P--W--T--V--G--K--N--E--F--S--
ATCTCAGTTGCTGAGAACGGCCTACAGTGCCCCACACCCCAGGTGTGTGTGTCCTCCTGCCCGGAGGACCCATGGACTGTGGGAAAAAACGAGTTCTCAC
::: :.::.::. ::::.::.::. : ::::::::.::::::::::::::::::::::::::.: :: :.:::::::.:::: :: :::: ::.::::::
ATCGCGGTCGCCCAGAATGGTCTGGACTGCCCCACGCCCCAGGTGTGTGTGTCCTCCTGCCCAGCGGTCTCATGGACCGTGGCAACAAACCAGCTCTCAC
-I--A--V--A--Q--N--G--L--D--C--P--T--P--Q--V--C--V--S--S--C--P--A--V--S--W--T--V--A--T--N--Q--L--S--

-------------------------------------------------------------------><-------------------------------
Q--T--V--G--E--V--F--Y--T--K--N--R--N--F--C--L--P--G--V--P--W--N--M--T--V--I--T--S--L--Q--Q--E--L--C
AGACTGTTGGGGAAGTCTTCTATACAAAAAACAGGAACTTTTGTCTGCCAGGGGTACCCTGGAATATGACGGTGATCACAAGCCTGCAACAGGAACTCTG
:::: :::::: :.:: :::::..: . ::::::::.::::::::::::::::::.::. ::.:.:::                                
AGACGGTTGGGCAGGTGTTCTACGCTGCAAACAGGAGCTTTTGTCTGCCAGGGGTGCCTGGGGACATG--------------------------------
Q--T--V--G--Q--V--F--Y--A--A--N--R--S--F--C--L--P--G--V--P--G--D--M---------------------------------

----------------------------><----------------------------------------------------------------------
--P--S--F--L--L--P--S--A--P--A--L--G--R--C--F--P--W--T--N--V--T--P--P--A--L--P--G--I--T--N--D--T--T-
CCCCAGTTTCCTCCTCCCCTCTGCTCCAGCTCTGGGGCGCTGCTTTCCATGGACCAACGTTACTCCACCGGCGCTCCCAGGGATCACCAATGACACCACC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------><----------------------------------------------------------------------------------
-I--Q--Q--G--I--S--G--L--I--D--S--L--N--A--R--D--I--S--V--K--I--F--E--D--F--A--Q--S--W--Y--W--I--L--
ATACAGCAGGGGATCAGCGGTCTTATTGACAGCCTCAATGCCCGAGACATCAGTGTTAAGATCTTTGAAGATTTTGCCCAGTCCTGGTATTGGATTCTTG
                  :::::: ::::::::::::::::::: ::::::::.::.::::::::::::::.::::::::::::::::::::::::::: 
------------------GGTCTTCTTGACAGCCTCAATGCCCGCGACATCAGCGTCAAGATCTTTGAAGACTTTGCCCAGTCCTGGTATTGGATTCTT-
-------------------G--L--L--D--S--L--N--A--R--D--I--S--V--K--I--F--E--D--F--A--Q--S--W--Y--W--I--L--

><--------------------------------------------------------------------------------------------------
V--A--L--G--V--A--L--V--L--S--L--L--F--I--L--L--L--R--L--V--A--G--P--L--V--L--V--L--I--L--G--V--L--G
TTGCCCTGGGGGTGGCTCTGGTCTTGAGCCTACTGTTTATCTTGCTTCTGCGCCTGGTGGCTGGGCCCCTGGTGCTGGTGCTGATCCTGGGAGTGCTGGG
  :::::.:: ::::::::::::.:::::::.::::::.::.::::::::::::::::::::::::::::::::.: ::::::::: :.:::::::::::
--GCCCTAGGCGTGGCTCTGGTCCTGAGCCTGCTGTTTGTCCTGCTTCTGCGCCTGGTGGCTGGGCCCCTGGTGTTCGTGCTGATCATAGGAGTGCTGGG
---A--L--G--V--A--L--V--L--S--L--L--F--V--L--L--L--R--L--V--A--G--P--L--V--F--V--L--I--I--G--V--L--G

----------------------------------------------------------------------------------------------------
--V--L--A--Y--G--I--Y--Y--C--W--E--E--Y--R--V--L--R--D--K--G--A--S--I--S--Q--L--G--F--T--T--N--L--S-
CGTGCTGGCATACGGCATCTACTACTGCTGGGAGGAGTACCGAGTGCTGCGGGACAAGGGCGCCTCCATCTCCCAGCTGGGTTTCACCACCAACCTCAGT
 :::::::: ::.:::::::::.::::::::.: ::::::::  :::::::::::::::::::::::::.:::::::::::.:::::::::::::::::.
GGTGCTGGCCTATGGCATCTACCACTGCTGGAACGAGTACCGCTTGCTGCGGGACAAGGGCGCCTCCATTTCCCAGCTGGGCTTCACCACCAACCTCAGC
--V--L--A--Y--G--I--Y--H--C--W--N--E--Y--R--L--L--R--D--K--G--A--S--I--S--Q--L--G--F--T--T--N--L--S-

------------------------------------><--------------------------------------------------------------
-A--Y--Q--S--V--Q--E--T--W--L--A--A--L--I--V--L--A--V--L--E--A--I--L--L--L--M--L--I--F--L--R--Q--R--
GCCTACCAGAGCGTGCAGGAGACCTGGCTGGCCGCCCTGATCGTGTTGGCGGTGCTTGAAGCCATCCTGCTGCTGATGCTCATCTTCCTGCGGCAGCGGA
:::::: . ::::: ::::::::::::::.:: :::   ::: ::.:::: :::::::::: :::::::::.::.:::::::::::::::::::::::::
GCCTACAGCAGCGTCCAGGAGACCTGGCTAGCAGCC---ATCCTGCTGGCTGTGCTTGAAGGCATCCTGCTACTAATGCTCATCTTCCTGCGGCAGCGGA
-A--Y--S--S--V--Q--E--T--W--L--A--A-----I--L--L--A--V--L--E--G--I--L--L--L--M--L--I--F--L--R--Q--R--

------------------------------------><--------------------------------------------------------------
I--R--I--A--I--A--L--L--K--E--A--S--K--A--V-----G--Q--M--M--S--T--M--F--Y--P--L--V--T--F--V--L--L--L
TTCGTATTGCCATCGCCCTCCTGAAGGAGGCCAGCAAGGCTGTG---GGACAGATGATGTCTACCATGTTCTACCCACTGGTCACCTTTGTCCTCCTCCT
::::.:: :::::.:::::::::.::::.::::::   :::::.    : ::::::::::::::: ::::::::::.:::::::::::.:::::::: ::
TTCGCATAGCCATTGCCCTCCTGGAGGAAGCCAGC---GCTGTAG--TGCCAGATGATGTCTACCCTGTTCTACCCGCTGGTCACCTTCGTCCTCCTGCT
I--R--I--A--I--A--L--L--E--E--A--S-----A--V--\--G--Q--M--M--S--T--L--F--Y--P--L--V--T--F--V--L--L--L

------------------------------------------------------------------><--------------------------------
--I--C--I--A--Y--W--A--M--T--A--L--Y--P--L--P--T--Q--P--A--T--L--G--Y--V--L--W--A--S--N--I--S--S--P-
CATCTGCATTGCCTACTGGGCCATGACTGCTCTGTATCCTCTGCCCACGCAGCCAGCCACTCTTGGATATGTGCTCTGGGCATCCAACATCAGCTCCCCC
:.:::::::::::::::::::::::::.::.::.::.                              ::.::::::::::::.:::::.:::::..  : 
CGTCTGCATTGCCTACTGGGCCATGACCGCCCTATAC------------------------------TACGTGCTCTGGGCACCCAACGTCAGCCTGGCG
--V--C--I--A--Y--W--A--M--T--A--L--Y--------------------------------Y--V--L--W--A--P--N--V--S--L--A-

-----------------------------------------><---------------------------------------------------------
-G--C--E--K--V--P--I--N--T--S--C--N--P--T--A--H--L--V--N--S--S--C--P--G--L--M--C--V--F--Q--G--Y--S--
GGCTGTGAGAAAGTGCCAATAAATACATCATGCAACCCCACGGCCCACCTTGTGAACTCCTCGTGCCCAGGGCTGATGTGCGTCTTCCAGGGCTACTCAT
::::::::::::::: ..::.:::::::::::..:::::            ::::::::: : ::::::::::::::::::::::::::::::::::..:
GGCTGTGAGAAAGTGATGATGAATACATCATGTGACCCC------------GTGAACTCCACCTGCCCAGGGCTGATGTGCGTCTTCCAGGGCTACTTGT
-G--C--E--K--V--M--M--N--T--S--C--D--P--------------V--N--S--T--C--P--G--L--M--C--V--F--Q--G--Y--L--

----------------------------------------------------------------------------------------------------
S--K--G--L--I--Q--R--S--V--F--N--L--Q--I--Y--G--V--L--G--L--F--W--T--L--N--W--V--L--A--L--G--Q--C--V
CCAAAGGCCTAATCCAACGTTCTGTCTTCAATCTGCAAATCTATGGGGTCCTGGGGCTCTTCTGGACCCTTAACTGGGTACTGGCCCTGGGCCAATGCGT
::: ::::::..: ::::::::: :::::::..::::::::::.:::::::::::::: ::::::::: :.:::::::: ::::::::::::::.::.::
CCACAGGCCTGGTACAACGTTCTCTCTTCAACTTGCAAATCTACGGGGTCCTGGGGCTATTCTGGACCATCAACTGGGTCCTGGCCCTGGGCCAGTGTGT
S--T--G--L--V--Q--R--S--L--F--N--L--Q--I--Y--G--V--L--G--L--F--W--T--I--N--W--V--L--A--L--G--Q--C--V

-----------------------------------------------------------------------------------------------><---
--L--A--G--A--F--A--S--F--Y--W--A--F--H--K--P--Q--D--I--P--T--F--P--L--I--S--A--F--I--R--T--L--R--Y-
CCTCGCTGGAGCCTTTGCCTCCTTCTACTGGGCCTTCCACAAGCCCCAGGACATCCCTACCTTCCCCTTAATCTCTGCCTTCATCCGCACACTCCGTTAC
::: :::::.:::::.:::::::::::::::::::::::::::::::.::::::.::::::::.:::.:.: ::::::::::::::::::::::   ::.
CCTGGCTGGGGCCTTCGCCTCCTTCTACTGGGCCTTCCACAAGCCCCGGGACATTCCTACCTTTCCCCTGAGCTCTGCCTTCATCCGCACACTC---TAT
--L--A--G--A--F--A--S--F--Y--W--A--F--H--K--P--R--D--I--P--T--F--P--L--S--S--A--F--I--R--T--L-----Y-

------------------------------------------------------------------------------------------><--------
-H--T--G--S--L--A--F--G--A--L--I--L--T--L--V--Q--I--A--R--V--I--L--E--Y--I--D--H--K--L--R--G--V--Q--
CACACTGGGTCATTGGCATTTGGAGCCCTCATCCTGACCCTTGTGCAGATAGCCCGGGTCATCTTGGAGTATATTGACCACAAGCTCAGAGGAGTGCAGA
:::::::::::..:.:: ::.:::::::::::::::::::: ::::::::::: ::::.::::.:::::::.:::::::::::.:: :::   :. ::::
CACACTGGGTCGCTAGCCTTCGGAGCCCTCATCCTGACCCTGGTGCAGATAGCACGGGCCATCCTGGAGTACATTGACCACAAACTGAGA---GCCCAGA
-H--T--G--S--L--A--F--G--A--L--I--L--T--L--V--Q--I--A--R--A--I--L--E--Y--I--D--H--K--L--R-----A--Q--

----------------------------------------------------------------------------------------------><----
N--P--V--A--R--C--I--M--C--C--F--K--C--C--L--W--C--L--E--K--F--I--K--F--L--N--R--N--A--Y--I--M--I--A
ACCCTGTAGCCCGCTGCATCATGTGCTGTTTCAAGTGCTGCCTCTGGTGTCTGGAAAAATTTATCAAGTTCCTAAACCGCAATGCATACATCATGATCGC
:::: ::.::::::::.:::::::::::.:::::::::::::::::::::.:::::::.::::::::::::::.:::::.:::::::::::::::::.::
ACCCGGTGGCCCGCTGTATCATGTGCTGCTTCAAGTGCTGCCTCTGGTGTTTGGAAAAGTTTATCAAGTTCCTGAACCGTAATGCATACATCATGATTGC
N--P--V--A--R--C--I--M--C--C--F--K--C--C--L--W--C--L--E--K--F--I--K--F--L--N--R--N--A--Y--I--M--I--A

--------------------------------------------------------------------><------------------------------
--I--Y--G--K--N--F--C--V--S--A--K--N--A--F--M--L--L--M--R--N--I--V--R--V--V--V--L--D--K--V--T--D--L-
CATCTACGGGAAGAATTTCTGTGTCTCAGCCAAAAATGCGTTCATGCTACTCATGCGAAACATTGTCAGGGTGGTCGTCCTGGACAAAGTCACAGACCTG
::::::.:::::::::::::::::::::::::::::.:: ::::::::.::::::::.:::::::::   ::.:::::::::::.:::::::: ::..:.
CATCTATGGGAAGAATTTCTGTGTCTCAGCCAAAAACGCCTTCATGCTGCTCATGCGGAACATTGTC---GTAGTCGTCCTGGATAAAGTCACTGATTTA
--I--Y--G--K--N--F--C--V--S--A--K--N--A--F--M--L--L--M--R--N--I--V-----V--V--V--L--D--K--V--T--D--L-

---------------------------------------><-----------------------------------------------------------
-L--L--F--F--G--K--L--L--V--V--G--G--V--G--V--L--S--F--F--F--F--S--G--R--I--P--G--L--G--K--D--F--K--
CTGCTGTTCTTTGGGAAGCTGCTGGTGGTCGGAGGCGTGGGGGTCCTGTCCTTCTTTTTTTTCTCCGGTCGCATCCCGGGGCTGGGTAAAGACTTTAAGA
::::: :::::::::::::::::::::::::::::.      :::::::::::::::::.::: :::::::::::: :::.:::::::::::::::.:::
CTGCTCTTCTTTGGGAAGCTGCTGGTGGTCGGAGGT------GTCCTGTCCTTCTTTTTCTTCACCGGTCGCATCCAGGGACTGGGTAAAGACTTTGAGA
-L--L--F--F--G--K--L--L--V--V--G--G--------V--L--S--F--F--F--F--T--G--R--I--Q--G--L--G--K--D--F--E--

----------------------------------><----------------------------------------------------------------
S--P--H--L--N--Y--Y--W--L--P--I--M--T--S--I--L--G--A--Y--V--I--A--S--G--F--F--S--V--F--G--M--C--V--D
GCCCCCACCTCAACTATTACTGGCTGCCCATCATGACCTCCATCCTGGGGGCCTATGTCATCGCCAGCGGCTTCTTCAGCGTTTTCGGCATGTGTGTGGA
:.::::: :::::::::::::::::::::::::::::::::::: ::::.:::::.:::::::::::.::::::::::::::::::::::::::::::::
GTCCCCAGCTCAACTATTACTGGCTGCCCATCATGACCTCCATCATGGGAGCCTACGTCATCGCCAGTGGCTTCTTCAGCGTTTTCGGCATGTGTGTGGA
S--P--Q--L--N--Y--Y--W--L--P--I--M--T--S--I--M--G--A--Y--V--I--A--S--G--F--F--S--V--F--G--M--C--V--D

-------------------><-------------------------------------------------------------------------------
--T--L--F--L--C--F--L--E--D--L--E--R--N--N--G--S--L--D--R--P--Y--Y--M--S--K--S--L--L--K--I--L--G--K-
CACGCTCTTCCTCTGCTTCCTGGAAGACCTGGAGCGGAACAACGGCTCCCTGGACCGGCCCTACTACATGTCCAAGAGCCTTCTAAAGATTCTGGGCAAG
.:: :::::::::::.:::   :::::::::::: :::::.::::::::::::::::::::::::::::::::::.. ::::::.:::::::::::::::
TACTCTCTTCCTCTGTTTC---GAAGACCTGGAGAGGAACGACGGCTCCCTGGACCGGCCCTACTACATGTCCAAAGCCCTTCTGAAGATTCTGGGCAAG
--T--L--F--L--C--F-----E--D--L--E--R--N--D--G--S--L--D--R--P--Y--Y--M--S--K--A--L--L--K--I--L--G--K-

----------------------------------------->
-K--N--E--A--P--P--D--N--K--K--R--K--K--*-
AAGAACGAGGCGCCCCCGGACAACAAGAAGAGGAAGAAGTGA
::::::::::.::::.:::. .::::::.::.::::::::::
AAGAACGAGGTGCCCTCGGGAGACAAGAGGAAGAAGAAGTGA
-K--N--E--V--P--S--G--D--K--R--K--K--K--*-

Pig Consensus Sequence

>BGISUST0000890084
----------------------------------------------------------------------------------------------------
-----------------------------------------------------------------TGGGTCTATGGAGACCCCCAGCAAGTCCTCTACCC
CCGGAACTCTTCTGGGGCCTATTGCGGGATCGGGGAAAAC---GATAAACCCTATCTCCTGTACTTCAACATCTTCAGCTGCGTCCTAACCACCAACATC
ATCGCGGTCGCCCAGAATGGTCTGGACTGCCCCACGCCCCAGGTGTGTGTGTCCTCCTGCCCAGCGGTCTCATGGACCGTGGCAACAAACCAGCTCTCAC
AGACGGTTGGGCAGGTGTTCTACGCTGCAAACAGGAGCTTTTGTCTGCCAGGGGTGCCTGGGGACATG--------------------------------
----------------------------------------------------------------------------------------------------
------------------GGTCTTCTTGACAGCCTCAATGCCCGCGACATCAGCGTCAAGATCTTTGAAGACTTTGCCCAGTCCTGGTATTGGATTCTT-
--GCCCTAGGCGTGGCTCTGGTCCTGAGCCTGCTGTTTGTCCTGCTTCTGCGCCTGGTGGCTGGGCCCCTGGTGTTCGTGCTGATCATAGGAGTGCTGGG
GGTGCTGGCCTATGGCATCTACCACTGCTGGAACGAGTACCGCTTGCTGCGGGACAAGGGCGCCTCCATTTCCCAGCTGGGCTTCACCACCAACCTCAGC
GCCTACAGCAGCGTCCAGGAGACCTGGCTAGCAGCC---ATCCTGCTGGCTGTGCTTGAAGGCATCCTGCTACTAATGCTCATCTTCCTGCGGCAGCGGA
TTCGCATAGCCATTGCCCTCCTGGAGGAAGCCAGC---GCTGTatGCCAGATGATGTCTACCCTGTTCTACCCGCTGGTCACCTTCGTCCTCCTGCTCGT
CTGCATTGCCTACTGGGCCATGACCGCCCTATAC------------------------------TACGTGCTCTGGGCACCCAACGTCAGCCTGGCGGGC
TGTGAGAAAGTGATGATGAATACATCATGTGACCCC------------GTGAACTCCACCTGCCCAGGGCTGATGTGCGTCTTCCAGGGCTACTTGTCCA
CAGGCCTGGTACAACGTTCTCTCTTCAACTTGCAAATCTACGGGGTCCTGGGGCTATTCTGGACCATCAACTGGGTCCTGGCCCTGGGCCAGTGTGTCCT
GGCTGGGGCCTTCGCCTCCTTCTACTGGGCCTTCCACAAGCCCCGGGACATTCCTACCTTTCCCCTGAGCTCTGCCTTCATCCGCACACTC---TATCAC
ACTGGGTCGCTAGCCTTCGGAGCCCTCATCCTGACCCTGGTGCAGATAGCACGGGCCATCCTGGAGTACATTGACCACAAACTGAGA---GCCCAGAACC
CGGTGGCCCGCTGTATCATGTGCTGCTTCAAGTGCTGCCTCTGGTGTTTGGAAAAGTTTATCAAGTTCCTGAACCGTAATGCATACATCATGATTGCCAT
CTATGGGAAGAATTTCTGTGTCTCAGCCAAAAACGCCTTCATGCTGCTCATGCGGAACATTGTC---GTAGTCGTCCTGGATAAAGTCACTGATTTACTG
CTCTTCTTTGGGAAGCTGCTGGTGGTCGGAGGT------GTCCTGTCCTTCTTTTTCTTCACCGGTCGCATCCAGGGACTGGGTAAAGACTTTGAGAGTC
CCCAGCTCAACTATTACTGGCTGCCCATCATGACCTCCATCATGGGAGCCTACGTCATCGCCAGTGGCTTCTTCAGCGTTTTCGGCATGTGTGTGGATAC
TCTCTTCCTCTGTTTC---GAAGACCTGGAGAGGAACGACGGCTCCCTGGACCGGCCCTACTACATGTCCAAAGCCCTTCTGAAGATTCTGGGCAAGAAG
AACGAGGTGCCCTCGGGAGACAAGAGGAAGAAGAAGTGA


>BGISUSP0000890084
-------------------------------------------------------WVYGDPQQVLYPRNSSGAYCGIGEN-DKPYLLYFNIFSCVLTTNI
IAVAQNGLDCPTPQVCVSSCPAVSWTVATNQLSQTVGQVFYAANRSFCLPGVPGDM--------------------------------------------
------GLLDSLNARDISVKIFEDFAQSWYWIL-ALGVALVLSLLFVLLLRLVAGPLVFVLIIGVLGVLAYGIYHCWNEYRLLRDKGASISQLGFTTNLS
AYSSVQETWLAA-ILLAVLEGILLLMLIFLRQRIRIAIALLEEAS-AVCQMMSTLFYPLVTFVLLLVCIAYWAMTALY----------YVLWAPNVSLAG
CEKVMMNTSCDP----VNSTCPGLMCVFQGYLSTGLVQRSLFNLQIYGVLGLFWTINWVLALGQCVLAGAFASFYWAFHKPRDIPTFPLSSAFIRTL-YH
TGSLAFGALILTLVQIARAILEYIDHKLR-AQNPVARCIMCCFKCCLWCLEKFIKFLNRNAYIMIAIYGKNFCVSAKNAFMLLMRNIV-VVVLDKVTDLL
LFFGKLLVVGG--VLSFFFFTGRIQGLGKDFESPQLNYYWLPIMTSIMGAYVIASGFFSVFGMCVDTLFLCF-EDLERNDGSLDRPYYMSKALLKILGKK
NEVPSGDKRKKK*