Sequences
EST Library Info
ebs1Foetus 50 days, brain stem
eep1Foetus 50 days, epidermis
jej1Small intestine, jejunum
nco1Newborn 115 days, colon
nlu1Newborn 115 days, lung
pigcb2Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000112498 (click for geneview)
Transcript ID ENST00000230260(link to ensembl)
Symbol PPP1R11
Localtion Chromosome:6:30142968:30146085:1 band: 6p21.33
Description protein phosphatase 1, regulatory (inhibitor) subunit 11 isoform 1 [Source:RefSeq_peptide;Acc:NP_068778]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-------------------------------------------------------------------><------------------------------
-M--A--E--A--G--A--G--L--S--E--T--V--T--E--T--T--V--T--V--T--T--E--P--E--N--R--S--L--T--I--K--L--R--
ATGGCCGAGGCAGGGGCTGGGCTGAGCGAGACCGTCACTGAGACAACGGTTACCGTGACAACCGAGCCCGAGAACCGGAGCCTTACCATCAAACTTCGGA
::::: :::::::::::.::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::: ::::::::::::::::
ATGGCGGAGGCAGGGGCCGGGCTGAGTGAGACCGTCACTGAGACAACGGTTACCGTGACAACCGAGCCCGAGAACCGGAGCCTAACCATCAAACTTCGGA
-M--A--E--A--G--A--G--L--S--E--T--V--T--E--T--T--V--T--V--T--T--E--P--E--N--R--S--L--T--I--K--L--R--

-----------------------------------------------------------------------------><---------------------
K--R--K--P--E--K--K--V--E--W--T--S--D--T--V--D--N--E--H--M--G--R--R--S--S--K--C--C--C--I--Y--E--K--P
AACGGAAGCCAGAGAAAAAGGTAGAATGGACAAGTGACACTGTGGACAATGAACACATGGGCCGCCGCTCATCCAAATGCTGCTGTATTTATGAGAAACC
:::::::::::::::::::::::::::::::.:::::::::::::::::.::::::::::: ::::::::::: :::   ::::::::::::::::::::
AACGGAAGCCAGAGAAAAAGGTAGAATGGACGAGTGACACTGTGGACAACGAACACATGGGGCGCCGCTCATCAAAA---TGCTGTATTTATGAGAAACC
K--R--K--P--E--K--K--V--E--W--T--S--D--T--V--D--N--E--H--M--G--R--R--S--S--K-----C--C--I--Y--E--K--P

----------------------------------------------------------------------------------------------------
--R--A--F--G--E--S--S--T--E--S--D--E--E--E--E--E--G--C--G--H--T--H--C--V--R--G--H--R--K--G--R--R--R-
TCGGGCCTTTGGCGAGAGCTCCACGGAAAGTGATGAGGAGGAAGAAGAGGGCTGTGGTCATACACACTGTGTACGTGGCCACCGCAAAGGACGGCGTCGT
::::::::::::::::::.::::::::.:::::::::::::::::.::::::::::::::::::::::::::::: ::::::::::::::::::::::::
TCGGGCCTTTGGCGAGAGTTCCACGGAGAGTGATGAGGAGGAAGAGGAGGGCTGTGGTCATACACACTGTGTACGGGGCCACCGCAAAGGACGGCGTCGT
--R--A--F--G--E--S--S--T--E--S--D--E--E--E--E--E--G--C--G--H--T--H--C--V--R--G--H--R--K--G--R--R--R-

-------------------------------------------------------------------------------->
-A--T--L--G--P--T--P--T--T--P--P--Q--P--P--D--P--S--Q--P--P--P--G--P--M--Q--H--*-
GCAACCCTAGGACCGACCCCCACCACCCCTCCCCAGCCTCCTGACCCTTCCCAGCCCCCTCCAGGGCCAATGCAGCACTAA
:::::::..:::::.: ::::::::::::::: ::::::::.:::::.:::::::::::::::::::::::::::::::::
GCAACCCCGGGACCAAGCCCCACCACCCCTCCGCAGCCTCCCGACCCCTCCCAGCCCCCTCCAGGGCCAATGCAGCACTAA
-A--T--P--G--P--S--P--T--T--P--P--Q--P--P--D--P--S--Q--P--P--P--G--P--M--Q--H--*-

Pig Consensus Sequence

>BGISUST0000898858
ATGGCGGAGGCAGGGGCCGGGCTGAGTGAGACCGTCACTGAGACAACGGTTACCGTGACAACCGAGCCCGAGAACCGGAGCCTAACCATCAAACTTCGGA
AACGGAAGCCAGAGAAAAAGGTAGAATGGACGAGTGACACTGTGGACAACGAACACATGGGGCGCCGCTCATCAAAA---TGCTGTATTTATGAGAAACC
TCGGGCCTTTGGCGAGAGTTCCACGGAGAGTGATGAGGAGGAAGAGGAGGGCTGTGGTCATACACACTGTGTACGGGGCCACCGCAAAGGACGGCGTCGT
GCAACCCCGGGACCAAGCCCCACCACCCCTCCGCAGCCTCCCGACCCCTCCCAGCCCCCTCCAGGGCCAATGCAGCACTAA


>BGISUSP0000898858
MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDNEHMGRRSSK-CCIYEKPRAFGESSTESDEEEEEGCGHTHCVRGHRKGRRR
ATPGPSPTTPPQPPDPSQPPPGPMQH*