Sequences
EST Library Info
aor1Aorta
che1Heart - RNA from China
cki1Kidney - RNA from China
cov1Ovary - RNA from China
cst1Stomach - RNA from China
dbla1Unavailable
ebs1Foetus 50 days, brain stem
ecc1Foetus 50 days, cortex cerebri
eje1Foetus 50 days, jejunum
fat1Fatt
fcc2Unavailable
gul3Gullet
hyp2Hypothalamus
jca1Joint capsule
lin2Large intestine
lyg2Lymphatic gland
mga2Mammary gland - 7 days after weaning
nbm1Newborn 115 days, bone marrow (pelvis)
nca1Newborn 115 days, cartillage
nco1Newborn 115 days, colon
nje1Newborn 115 days, jejunum
ova1Ovary
pfco3Unavailable
pgl1Pituitary gland
plac3Unavailable
rec1Rectum
ret3Retina
sag1Salivary gland
ski2Skin
spc5Spinal cord
ssp1M. Supraspinatus
ste2M. Semitendinosus
thg4Thyroid gland
tra2Trachea
uio2Unavailable
vin2M. Vastus intermedius
Clusters
Oligos
SNPs

Gene ID ENSG00000114784 (click for geneview)
Transcript ID ENST00000232905(link to ensembl)
Symbol SUI13_HUMAN
Localtion Chromosome:3:40326177:40328919:1 band: 3p22.1
Description Protein translation factor SUI1 homolog GC20.
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-----------------------------><--------------------------------------------------------------------
-M--S--T--I--Q--N--L--Q--S--F--D--P--F--A--D--A--T--K--G--D--D--L--L--P--A--G--T--E--D--Y--I--H--I--
ATGTCCACTATCCAGAACCTCCAATCTTTCGACCCCTTTGCTGATGCAACTAAGGGTGACGACTTACTCCCGGCAGGGACTGAGGATTACATTCATATAA
::::::::::::::::::::::::::::::   :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
ATGTCCACTATCCAGAACCTCCAATCTTTC---CCCTTTGCTGATGCAACTAAGGGTGACGACTTACTCCCGGCAGGGACTGAGGATTACATTCATATAA
-M--S--T--I--Q--N--L--Q--S--F-----P--F--A--D--A--T--K--G--D--D--L--L--P--A--G--T--E--D--Y--I--H--I--

----------------------------------------------------------------------------------------------><----
R--I--Q--Q--R--N--G--R--K--T--L--T--T--V--Q--G--I--A--D--D--Y--D--K--K--K--L--V--K--A--F--K--K--K--F
GAATCCAGCAACGGAACGGCAGAAAGACACTGACTACTGTTCAGGGCATTGCAGATGATTATGACAAAAAGAAACTTGTGAAAGCTTTCAAAAAGAAATT
::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
GAATCCAGCAACGGAACGGCAGGAAGACACTGACTACTGTTCAGGGCATTGCAGATGATTATGACAAAAAGAAACTTGTGAAAGCTTTCAAAAAGAAATT
R--I--Q--Q--R--N--G--R--K--T--L--T--T--V--Q--G--I--A--D--D--Y--D--K--K--K--L--V--K--A--F--K--K--K--F

------------------------------------------------------------------------------------------------><--
--A--C--N--G--T--V--I--E--H--P--E--Y--G--E--V--I--Q--L--Q--G--D--Q--R--K--N--I--C--Q--F--L--L--E--V-
TGCCTGTAATGGTACTGTGATTGAACATCCTGAATACGGAGAGGTTATTCAGCTTCAAGGTGACCAAAGAAAAAACATCTGCCAGTTTCTCTTGGAGGTT
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::
TGCCTGTAATGGTACTGTGATTGAACATCCTGAATACGGAGAGGTTATTCAGCTTCAAGGTGACCAAAGAAAAAACATTTGCCAGTTTCTCTTGGAGGTT
--A--C--N--G--T--V--I--E--H--P--E--Y--G--E--V--I--Q--L--Q--G--D--Q--R--K--N--I--C--Q--F--L--L--E--V-

----------------------------------------->
-G--I--V--K--E--E--Q--L--K--V--H--G--F--*-
GGCATTGTAAAGGAGGAACAGCTTAAGGTTCATGGATTCTAA
:::::::: ::.:::::.::.:::::::::::::::::::::
GGCATTGTCAAAGAGGAGCAACTTAAGGTTCATGGATTCTAA
-G--I--V--K--E--E--Q--L--K--V--H--G--F--*-

Pig Consensus Sequence

>BGISUST0000887019
ATGTCCACTATCCAGAACCTCCAATCTTTC---CCCTTTGCTGATGCAACTAAGGGTGACGACTTACTCCCGGCAGGGACTGAGGATTACATTCATATAA
GAATCCAGCAACGGAACGGCAGGAAGACACTGACTACTGTTCAGGGCATTGCAGATGATTATGACAAAAAGAAACTTGTGAAAGCTTTCAAAAAGAAATT
TGCCTGTAATGGTACTGTGATTGAACATCCTGAATACGGAGAGGTTATTCAGCTTCAAGGTGACCAAAGAAAAAACATTTGCCAGTTTCTCTTGGAGGTT
GGCATTGTCAAAGAGGAGCAACTTAAGGTTCATGGATTCTAA


>BGISUSP0000887019
MSTIQNLQSF-PFADATKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLLEV
GIVKEEQLKVHGF*