Sequences
EST Library Info
aor1Aorta
cbe2Cerebellum
cki3Kidney - RNA from China
cmu1Rhinal mucous membrane - RNA from China
cut2Uterus - RNA from China
dbla1Unavailable
eye2Foetus 50 days, Eye
gul1Gullet
hea2Heart
lin1Large intestine
med1Mediastinum
mga1Mammary gland - 7 days after weaning
mgm2Mammary gland - 14 days after birth
nbm1Newborn 115 days, bone marrow (pelvis)
nca1Newborn 115 days, cartillage
nep2Newborn 115 days, epidermis
nmm1Newborn 115 days, mucosal membranes
ova2Ovary
pgl2Pituitary gland
plac3Unavailable
pldo1Unavailable
plun2Unavailable
relu3Unavailable
ret2Retina
sme3M. Semimembranosus
spc3Spinal cord
ste1M. Semitendinosus
sto2Stomach
tes1Testes
thg2Thyroid gland
Clusters
Oligos
SNPs

Gene ID ENSG00000115350 (click for geneview)
Transcript ID ENST00000233699(link to ensembl)
Symbol POLE4
Localtion Chromosome:2:75097430:75108513:1 band: 2p12
Description DNA polymerase epsilon p12 subunit (DNA polymerase epsilon subunit 4). [Source:Uniprot/SWISSPROT;Acc:Q9NR33]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--A--A--A--A--A--G--S--G--T--P--R--E--E--E--G--P--A--G--E--A--A--A--S--Q--P--Q--A--P--T--S--V--
ATGGCGGCGGCGGCGGCGGCAGGAAGCGGGACGCCCCGAGAGGAGGAGGGACCTGCTGGGGAGGCAGCGGCCTCGCAGCCCCAGGCCCCAACGAGTGTGC
   ::::.:::::::::.:: :::::.::: :  ::::.::.::::: .: .: :::::::::::.::::::.::::::::::.:::::.::.:::..::
---GCGGTGGCGGCGGCAGCTGGAAGTGGGCCTGCCCGGGAAGAGGACAGCTCAGCTGGGGAGGCGGCGGCCCCGCAGCCCCAAGCCCCGACAAGTACGC
----A--V--A--A--A--A--G--S--G--P--A--R--E--E--D--S--S--A--G--E--A--A--A--P--Q--P--Q--A--P--T--S--T--

----------------------------------------------------------------------------------------------------
P--G--A--R--L--S--R--L--P--L--A--R--V--K--A--L--V--K--A--D--P--D--V--T--L--A--G--Q--E--A--I--F--I--L
CTGGGGCTCGTCTCTCGAGGTTGCCTCTGGCGCGAGTGAAGGCCTTGGTGAAGGCAGATCCCGACGTGACGCTAGCGGGACAGGAAGCCATCTTCATTCT
::::::::::::::::::::.:.::::::::::::::::::::::::::::::::.::.:::::::::::::: :::::::::::::::::::::::.::
CTGGGGCTCGTCTCTCGAGGCTACCTCTGGCGCGAGTGAAGGCCTTGGTGAAGGCGGACCCCGACGTGACGCTCGCGGGACAGGAAGCCATCTTCATCCT
P--G--A--R--L--S--R--L--P--L--A--R--V--K--A--L--V--K--A--D--P--D--V--T--L--A--G--Q--E--A--I--F--I--L

------------><-----------------------------------------------------------------------------------><-
--A--R--A--A--E--L--F--V--E--T--I--A--K--D--A--Y--C--C--A--Q--Q--G--K--R--K--T--L--Q--R--R--D--L--D-
GGCACGAGCCGCGGAACTGTTTGTGGAGACCATTGCAAAAGATGCCTACTGTTGCGCTCAGCAGGGAAAAAGGAAAACCCTTCAGAGGAGAGACTTGGAT
:::::::::::::::::::::::::::::::::::::::.:::::::::::.::.:::::.::::::::.:::::::::::::::::::::::.:::   
GGCACGAGCCGCGGAACTGTTTGTGGAGACCATTGCAAAGGATGCCTACTGCTGTGCTCAACAGGGAAAGAGGAAAACCCTTCAGAGGAGAGATTTG---
--A--R--A--A--E--L--F--V--E--T--I--A--K--D--A--Y--C--C--A--Q--Q--G--K--R--K--T--L--Q--R--R--D--L----

---------------------------------------><------------>
-N--A--I--E--A--V--D--E--F--A--F--L--E--G--T--L--D--*-
AATGCAATAGAAGCTGTGGATGAATTTGCTTTTCTGGAAGGTACTTTAGATTGA
::::::::::::::::::::.:::::::::::.::::::               
AATGCAATAGAAGCTGTGGACGAATTTGCTTTCCTGGAA---------------
-N--A--I--E--A--V--D--E--F--A--F--L--E----------------

Pig Consensus Sequence

>BGISUST0000895344
---GCGGTGGCGGCGGCAGCTGGAAGTGGGCCTGCCCGGGAAGAGGACAGCTCAGCTGGGGAGGCGGCGGCCCCGCAGCCCCAAGCCCCGACAAGTACGC
CTGGGGCTCGTCTCTCGAGGCTACCTCTGGCGCGAGTGAAGGCCTTGGTGAAGGCGGACCCCGACGTGACGCTCGCGGGACAGGAAGCCATCTTCATCCT
GGCACGAGCCGCGGAACTGTTTGTGGAGACCATTGCAAAGGATGCCTACTGCTGTGCTCAACAGGGAAAGAGGAAAACCCTTCAGAGGAGAGATTTG---
AATGCAATAGAAGCTGTGGACGAATTTGCTTTCCTGGAA---------------


>BGISUSP0000895344
-AVAAAAGSGPAREEDSSAGEAAAPQPQAPTSTPGARLSRLPLARVKALVKADPDVTLAGQEAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDL-
NAIEAVDEFAFLE-----