Sequences
EST Library Info
cov1Ovary - RNA from China
nje2Newborn 115 days, jejunum
Clusters
Oligos
SNPs

Gene ID ENSG00000115392 (click for geneview)
Transcript ID ENST00000233741(link to ensembl)
Symbol FANCL
Localtion Chromosome:2:58298031:58380165:-1 band: 2p16.1
Description Ubiquitin ligase protein PHF9 (EC 6.3.2.-) (Fanconi anemia group L protein) (FAAP 43). [Source:Uniprot/SWISSPROT;Acc:Q9NW38]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<----------------------------------------------------------------------------------------------><---
-M--A--V--T--E--A--S--L--L--R--Q--C--P--L--L--L--P--Q--N--R--S--K--T--V--Y--E--G--F--I--S--A--Q--G--
ATGGCGGTGACGGAAGCGAGCCTGTTGCGCCAGTGCCCCCTGCTTCTGCCCCAGAACCGGTCGAAAACCGTGTATGAGGGATTCATCTCGGCTCAGGGAA
::::::: :::::::::::: .::.:::: :::::::: ::::::::::::::::::::  ::::::::::::::::.::::::::.:::::::::    
ATGGCGGAGACGGAAGCGAGGTTGCTGCGGCAGTGCCCGCTGCTTCTGCCCCAGAACCGTGCGAAAACCGTGTATGAAGGATTCATTTCGGCTCAG----
-M--A--E--T--E--A--R--L--L--R--Q--C--P--L--L--L--P--Q--N--R--A--K--T--V--Y--E--G--F--I--S--A--Q-----

------------------------------------------------------><--------------------------------------------
R--D--F--H--L--R--I--V--L--P--E--D--L--Q--L--K--N--A--R--L--L--C--S--W--Q--L--R--T--I--L--S--G--Y--H
GAGACTTCCACCTTAGGATAGTGTTGCCTGAAGATTTACAACTGAAGAATGCAAGATTATTATGTAGTTGGCAGCTGAGAACAATACTTAGTGGATACCA
                                                        ::..:.::::::::::::::::::::::::::::.:::.::.::
--------------------------------------------------------TTGCTGTGTAGTTGGCAGCTGAGAACAATACTTAATGGGTATCA
---------------------------------------------------------L--L--C--S--W--Q--L--R--T--I--L--N--G--Y--H

---------------><-------------------------------------------------------><--------------------------
--R--I--V--Q--Q--R--M--Q--H--S--P--D--L--M--S--F--M--M--E--L--K--M--L--L--E--V--A--L--K--N--R--Q--E-
TCGAATAGTACAACAGAGAATGCAGCACTCTCCTGATCTAATGAGCTTTATGATGGAGTTGAAGATGCTTTTGGAAGTTGCCTTAAAGAATAGACAAGAG
::.:.:::::::::::::::::::.:::::::::::::::::::::::.::::::::.::::::::: :::::::::.:::.::::::::::.:::::::
TCAAGTAGTACAACAGAGAATGCAACACTCTCCTGATCTAATGAGCTTCATGATGGAATTGAAGATGGTTTTGGAAGCTGCTTTAAAGAATAAACAAGAG
--Q--V--V--Q--Q--R--M--Q--H--S--P--D--L--M--S--F--M--M--E--L--K--M--V--L--E--A--A--L--K--N--K--Q--E-

-------------------------------------------------------------------------><-------------------------
-L--Y--A--L--P--P--P--P--Q--F--Y--S--S--L--I--E--E--I--G--T--L--G--W--D--K--L--V--Y--A--D--T--C--F--
CTGTATGCACTACCTCCTCCTCCCCAGTTCTACTCAAGCCTTATTGAAGAGATAGGAACTCTTGGTTGGGATAAACTTGTGTATGCGGATACCTGCTTCA
::.::::.::.:::::::::::::::::::::::::::. ::.:::::::::::::::::::::::::::::   ::::::.:::.::::::.:::::.:
CTATATGTACCACCTCCTCCTCCCCAGTTCTACTCAAGTGTTGTTGAAGAGATAGGAACTCTTGGTTGGGAT---CTTGTGCATGTGGATACTTGCTTTA
-L--Y--V--P--P--P--P--P--Q--F--Y--S--S--V--V--E--E--I--G--T--L--G--W--D-----L--V--H--V--D--T--C--F--

----------------------------------------------------------------------><----------------------------
S--T--I--K--L--K--A--E--D--A--S--G--R--E--H--L--I--T--L--K--L--K--A--K--Y--P--A--E--S--P--D--Y--F--V
GTACCATCAAGTTAAAAGCAGAAGATGCTTCTGGTAGAGAGCATTTAATCACTCTCAAGTTGAAGGCAAAGTATCCTGCAGAATCACCAGATTATTTTGT
::::::::::::::::::: ::::::::::::::::::::::::.:::::::: ::::::::::::::::::::::::::::. : :::::::.: ::::
GTACCATCAAGTTAAAAGCTGAAGATGCTTCTGGTAGAGAGCATCTAATCACTGTCAAGTTGAAGGCAAAGTATCCTGCAGAGACCCCAGATTGTATTGT
S--T--I--K--L--K--A--E--D--A--S--G--R--E--H--L--I--T--V--K--L--K--A--K--Y--P--A--E--T--P--D--C--I--V

---------------------------------------><-----------------------------------------------------------
--D--F--P--V--P--F--C--A--S--W--T--P--Q--S--S--L--I--S--I--Y--S--Q--F--L--A--A--I--E--S--L--K--A--F-
GGATTTTCCTGTTCCATTTTGTGCCTCCTGGACACCTCAGAGCTCCTTAATAAGCATTTATAGTCAGTTTTTGGCAGCAATAGAATCACTAAAGGCATTC
:::::::::::::.:::::: ::..:: :::::::: :::::::::::::::::::::.::::.:::::::::: :::: ::::::::::.:::::::::
GGATTTTCCTGTTTCATTTTCTGTTTCGTGGACACCACAGAGCTCCTTAATAAGCATTCATAGCCAGTTTTTGGAAGCATTAGAATCACTGAAGGCATTC
--D--F--P--V--S--F--S--V--S--W--T--P--Q--S--S--L--I--S--I--H--S--Q--F--L--E--A--L--E--S--L--K--A--F-

------------------------------------------------------------------------------------------><--------
-W--D--V--M--D--E--I--D--E--K--T--W--V--L--E--P--E--K--P--P--R--S--A--T--A--R--R--I--A--L--G--N--N--
TGGGATGTTATGGATGAAATCGATGAGAAGACCTGGGTACTTGAGCCAGAAAAACCTCCACGGAGTGCAACAGCACGCAGAATTGCATTAGGTAATAATG
::::::::::::::::::::::::::::::::.:::::::::::::::::::::::: :::::::::: :::::::::::::::::::::   ::::::.
TGGGATGTTATGGATGAAATCGATGAGAAGACTTGGGTACTTGAGCCAGAAAAACCTACACGGAGTGCTACAGCACGCAGAATTGCATTA---AATAATA
-W--D--V--M--D--E--I--D--E--K--T--W--V--L--E--P--E--K--P--T--R--S--A--T--A--R--R--I--A--L-----N--N--

--------------------------------------------------------------------------><------------------------
V--S--I--N--I--E--V--D--P--R--H--P--T--M--L--P--E--C--F--F--L--G--A--D--H--V--V--K--P--L--G--I--K--L
TTTCCATAAATATAGAGGTAGACCCCAGGCATCCTACTATGCTTCCTGAGTGCTTCTTTCTTGGAGCTGACCATGTGGTAAAACCCCTGGGAATTAAGCT
 ::: :::::::::::::::::.::::::::::::::::::::::::::::::: .:::::::::::::::      :::::::::::::::::::::::
GTTCAATAAATATAGAGGTAGATCCCAGGCATCCTACTATGCTTCCTGAGTGCTGTTTTCTTGGAGCTGAC------GTAAAACCCCTGGGAATTAAGCT
S--S--I--N--I--E--V--D--P--R--H--P--T--M--L--P--E--C--C--F--L--G--A--D--------V--K--P--L--G--I--K--L

--------------------><------------------------------------------------------------------------------
--S--R--N--I--H--L--W--D--P--E--N--S--V--L--Q--N--L--K--D--V--L--E--I--D--F--P--A--R--A--I--L--E--K-
GAGCAGGAACATACATTTGTGGGATCCAGAAAATAGTGTGTTACAAAATTTGAAAGATGTTTTAGAAATTGATTTTCCAGCTCGTGCTATCCTGGAAAAA
::::::.::::::::::::   ::::::::::::::: ::::::::::::::::.::::::::::::::::: ::::::::::::::::::::::::::.
GAGCAGAAACATACATTTG---GATCCAGAAAATAGTCTGTTACAAAATTTGAAGGATGTTTTAGAAATTGA-TTTCCAGCTCGTGCTATCCTGGAAAAG
--S--R--N--I--H--L-----D--P--E--N--S--L--L--Q--N--L--K--D--V--L--E--I--D--F--P--A--R--A--I--L--E--K-

-----><---------------------------------------------------------------------------------------------
-S--D--F--T--M--D--C--G--I--C--Y--A--Y--Q--L--D--G--T--I--P--D--Q--V--C--D--N--S--Q--C--G--Q--P--F--
TCTGATTTTACTATGGATTGTGGAATTTGTTATGCTTATCAACTTGACGGTACCATTCCTGATCAAGTGTGTGATAATTCTCAGTGTGGACAACCTTTCC
::::::::: :::::::::::::::::::::::::.:::::::::::.:::..::::::::::::::::::::::::: : :::::::::::..::::::
TCTGATTTTTCTATGGATTGTGGAATTTGTTATGCCTATCAACTTGATGGTGTCATTCCTGATCAAGTGTGTGATAATGCACAGTGTGGACAGTCTTTCC
-S--D--F--S--M--D--C--G--I--C--Y--A--Y--Q--L--D--G--V--I--P--D--Q--V--C--D--N--A--Q--C--G--Q--S--F--

-------------------------><----------------------------------------------------------------------><-
H-----Q--I--C--L--Y--E--W--L--R--G--L--L--T--S--R--Q--S--F--N--I--I--F--G--E--C--P--Y--C--S--K--P--I
AT---CAAATATGCTTATATGAGTGGCTGAGAGGACTACTAACTAGTAGACAGAGTTTTAACATCATATTTGGTGAATGTCCATATTGTAGTAAGCCAAT
::   :::.::::::::::.::::::.::::::::::.::.::.:::::::::::::::::.:.::::::::::::::::::.::::::::::::     
ATC--CAAGTATGCTTATACGAGTGGTTGAGAGGACTGCTGACCAGTAGACAGAGTTTTAATACCATATTTGGTGAATGTCCGTATTGTAGTAAG-----
H--\--Q--V--C--L--Y--E--W--L--R--G--L--L--T--S--R--Q--S--F--N--T--I--F--G--E--C--P--Y--C--S--K------

-------------------------------
--T--L--K--M--S--G--R--K--H--*-
TACCTTAAAAATGTCTGGAAGGAAACACTGA
                               
-------------------------------
-------------------------------

Pig Consensus Sequence

>BGISUST0000901816
ATGGCGGAGACGGAAGCGAGGTTGCTGCGGCAGTGCCCGCTGCTTCTGCCCCAGAACCGTGCGAAAACCGTGTATGAAGGATTCATTTCGGCTCAG----
--------------------------------------------------------TTGCTGTGTAGTTGGCAGCTGAGAACAATACTTAATGGGTATCA
TCAAGTAGTACAACAGAGAATGCAACACTCTCCTGATCTAATGAGCTTCATGATGGAATTGAAGATGGTTTTGGAAGCTGCTTTAAAGAATAAACAAGAG
CTATATGTACCACCTCCTCCTCCCCAGTTCTACTCAAGTGTTGTTGAAGAGATAGGAACTCTTGGTTGGGAT---CTTGTGCATGTGGATACTTGCTTTA
GTACCATCAAGTTAAAAGCTGAAGATGCTTCTGGTAGAGAGCATCTAATCACTGTCAAGTTGAAGGCAAAGTATCCTGCAGAGACCCCAGATTGTATTGT
GGATTTTCCTGTTTCATTTTCTGTTTCGTGGACACCACAGAGCTCCTTAATAAGCATTCATAGCCAGTTTTTGGAAGCATTAGAATCACTGAAGGCATTC
TGGGATGTTATGGATGAAATCGATGAGAAGACTTGGGTACTTGAGCCAGAAAAACCTACACGGAGTGCTACAGCACGCAGAATTGCATTA---AATAATA
GTTCAATAAATATAGAGGTAGATCCCAGGCATCCTACTATGCTTCCTGAGTGCTGTTTTCTTGGAGCTGAC------GTAAAACCCCTGGGAATTAAGCT
GAGCAGAAACATACATTTG---GATCCAGAAAATAGTCTGTTACAAAATTTGAAGGATGTTTTAGAAATttTTCCAGCTCGTGCTATCCTGGAAAAGTCT
GATTTTTCTATGGATTGTGGAATTTGTTATGCCTATCAACTTGATGGTGTCATTCCTGATCAAGTGTGTGATAATGCACAGTGTGGACAGTCTTTCCAtc
AAGTATGCTTATACGAGTGGTTGAGAGGACTGCTGACCAGTAGACAGAGTTTTAATACCATATTTGGTGAATGTCCGTATTGTAGTAAG-----------
-------------------------


>BGISUSP0000901816
MAETEARLLRQCPLLLPQNRAKTVYEGFISAQ--------------------LLCSWQLRTILNGYHQVVQQRMQHSPDLMSFMMELKMVLEAALKNKQE
LYVPPPPPQFYSSVVEEIGTLGWD-LVHVDTCFSTIKLKAEDASGREHLITVKLKAKYPAETPDCIVDFPVSFSVSWTPQSSLISIHSQFLEALESLKAF
WDVMDEIDEKTWVLEPEKPTRSATARRIAL-NNSSINIEVDPRHPTMLPECCFLGAD--VKPLGIKLSRNIHL-DPENSLLQNLKDVLEIFPARAILEKS
DFSMDCGICYAYQLDGVIPDQVCDNAQCGQSFHQVCLYEWLRGLLTSRQSFNTIFGECPYCSK------------