Sequences
EST Library Info
cov11Ovary - RNA from China
cte2Testicle - RNA from China
dbla1Unavailable
nmm1Newborn 115 days, mucosal membranes
tes4Testes
Clusters
Oligos
SNPs

Gene ID ENSG00000116299 (click for geneview)
Transcript ID ENST00000234923(link to ensembl)
Symbol NP_065826.2
Localtion Chromosome:1:109368575:109461639:1 band: 1p13.3
Description maba1
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--E--P--G--H--S--H--H--L--S--A--R--V--R--G--R--T--E--R--R--I--P--R--L--W--R--L--L--L--W--A--G--
ATGGCTGAGCCTGGGCACAGCCACCATCTCTCCGCCAGAGTCAGGGGAAGAACTGAGAGGCGCATACCCCGGCTGTGGCGGCTGCTGCTCTGGGCTGGGA
:::::::::::::::::::::: :::::.:::.::::::: :::::::::::::::: ::::::.::.:::::: . :::::::::::::::::.:::::
ATGGCTGAGCCTGGGCACAGCCTCCATCCCTCTGCCAGAGGCAGGGGAAGAACTGAGCGGCGCACACTCCGGCTTCTGCGGCTGCTGCTCTGGGTTGGGA
-M--A--E--P--G--H--S--L--H--P--S--A--R--G--R--G--R--T--E--R--R--T--L--R--L--L--R--L--L--L--W--V--G--

----------------------------------------------------><----------------------------------------------
T--A--F--Q--V--T--Q--G--T--G--P--E--L--H--A--C--K--E--S--E--Y--H--Y--E--Y--T--A--C--D--S--T--G--S--R
CCGCCTTCCAGGTGACCCAGGGAACGGGACCGGAGCTTCATGCCTGCAAAGAGTCTGAGTACCACTATGAGTACACGGCGTGTGACAGCACGGGTTCCAG
::::::::::::::::.::::::.::::::.:::::::::.::::::::::::::::::::::::::.::.::::: :::::::::::::::::::::::
CCGCCTTCCAGGTGACTCAGGGAGCGGGACTGGAGCTTCACGCCTGCAAAGAGTCTGAGTACCACTACGAATACACTGCGTGTGACAGCACGGGTTCCAG
T--A--F--Q--V--T--Q--G--A--G--L--E--L--H--A--C--K--E--S--E--Y--H--Y--E--Y--T--A--C--D--S--T--G--S--R

-------------------------------------------------------------------------><-------------------------
--W--R--V--A--V--P--H--T--P--G--L--C--T--S--L--P--D--P--I--K--G--T--E--C--S--F--S--C--N--A--G--E--F-
GTGGAGGGTCGCCGTGCCGCATACCCCGGGCCTGTGCACCAGCCTGCCTGACCCCATCAAGGGCACCGAGTGCTCCTTCTCCTGCAACGCCGGGGAGTTT
::::::.:::::::::::.::.:::::.::::::::::::::::: :::::::: .:::::::::::::::::   :::::.::::: ::::::::::::
GTGGAGAGTCGCCGTGCCACACACCCCAGGCCTGTGCACCAGCCTCCCTGACCCAGTCAAGGGCACCGAGTGC---TTCTCTTGCAAAGCCGGGGAGTTT
--W--R--V--A--V--P--H--T--P--G--L--C--T--S--L--P--D--P--V--K--G--T--E--C-----F--S--C--K--A--G--E--F-

----------------------------------------------------------------------------------------------------
-L--D--M--K--D--Q--S--C--K--P--C--A--E--G--R--Y--S--L--G--T--G--I--R--F--D--E--W--D--E--L--P--H--G--
CTGGATATGAAGGACCAGTCATGTAAGCCATGCGCTGAGGGCCGCTACTCCCTCGGCACAGGCATTCGGTTTGATGAGTGGGATGAGCTGCCCCATGGCT
:::::.::::::::::::::.::::::::.:::::::::::::::::::::::.:::::::::::.:::::.::.::.::::::::::::::::::::::
CTGGACATGAAGGACCAGTCGTGTAAGCCGTGCGCTGAGGGCCGCTACTCCCTTGGCACAGGCATCCGGTTCGACGAATGGGATGAGCTGCCCCATGGCT
-L--D--M--K--D--Q--S--C--K--P--C--A--E--G--R--Y--S--L--G--T--G--I--R--F--D--E--W--D--E--L--P--H--G--

------------------------------------------------------------------><--------------------------------
F--A--S--L--S--A--N--M--E--L--D--D--S--A--A--E--S--T--G--N--C--T--S--S--K--W--V--P--R--G--D--Y--I--A
TTGCCAGCCTCTCAGCCAACATGGAGCTGGATGACAGTGCTGCTGAGTCCACCGGGAACTGTACTTCGTCCAAGTGGGTTCCCCGGGGCGACTACATCGC
::::::::::::::.::::::::::: : :: :::::..:...::.:::::::::::::::.:::   ::::::::::::::.: ::::::::::::: :
TTGCCAGCCTCTCAACCAACATGGAGATTGAAGACAGCACCATTGGGTCCACCGGGAACTGCACT---TCCAAGTGGGTTCCTCTGGGCGACTACATCTC
F--A--S--L--S--T--N--M--E--I--E--D--S--T--I--G--S--T--G--N--C--T-----S--K--W--V--P--L--G--D--Y--I--S

----------------------------------------------------------------------------------------------------
--S--N--T--D--E--C--T--A--T--L--M--Y--A--V--N--L--K--Q--S--G--T--V--N--F--E--Y--Y--Y--P--D--S--S--I-
CTCCAACACGGACGAATGCACAGCCACACTGATGTACGCCGTCAACCTGAAGCAATCTGGCACCGTTAACTTCGAATACTACTATCCAGACTCCAGCATC
::::::::::::.::.:::::::::::.::::::::::::::::::::::::::.:::::::::::::::::.::.::::::::.:::::.::.::::::
CTCCAACACGGATGAGTGCACAGCCACGCTGATGTACGCCGTCAACCTGAAGCAGTCTGGCACCGTTAACTTTGAGTACTACTACCCAGATTCTAGCATC
--S--N--T--D--E--C--T--A--T--L--M--Y--A--V--N--L--K--Q--S--G--T--V--N--F--E--Y--Y--Y--P--D--S--S--I-

--------------><-------------------------------------------------------------------------------><---
-I--F--E--F--F--V--Q--N--D--Q--C--Q--P--N--A--D--D--S--R--W--M--K--T--T--E--K--G--W--E--F--H--S--V--
ATCTTTGAGTTTTTCGTTCAGAATGACCAGTGCCAGCCCAATGCAGATGACTCCAGGTGGATGAAGACCACAGAGAAAGGATGGGAATTCCACAGTGTGG
:::::.:::      ::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::   ::::
ATCTTCGAG------GTTCAGAATGACCAGTGCCAGCCCAATGCAGATGACTCCAGGTGGATGAAAACCACAGAGAAAGGATGGGAATTCCAC---GTGG
-I--F--E--------V--Q--N--D--Q--C--Q--P--N--A--D--D--S--R--W--M--K--T--T--E--K--G--W--E--F--H-----V--

----------------------------------------------------------------------------------------------------
E--L--N--R--G--N--N--V--L--Y--W--R--T--T--A--F--S--V--W--T--K--V--P--K--P--V--L--V--R--N--I--A--I--T
AGCTAAATCGAGGCAATAATGTCCTCTATTGGAGAACCACAGCCTTCTCAGTATGGACCAAAGTACCCAAGCCTGTGCTGGTGAGAAACATTGCCATAAC
:::::::::::::::::::.:::::::::::::::::::: ::::::::.::.::: ::::::: .::::::::::::::::: :::::::.::::::::
AGCTAAATCGAGGCAATAACGTCCTCTATTGGAGAACCACTGCCTTCTCGGTGTGGTCCAAAGTTTCCAAGCCTGTGCTGGTGCGAAACATCGCCATAAC
E--L--N--R--G--N--N--V--L--Y--W--R--T--T--A--F--S--V--W--S--K--V--S--K--P--V--L--V--R--N--I--A--I--T

-><-------------------------------------------------------------------------------------------------
--G--V--A--Y--T--S--E--C--F--P--C--K--P--G--T--Y--A--D--K--Q--G--S--S--F--C--K--L--C--P--A--N--S--Y-
AGGGGTGGCCTACACTTCAGAATGCTTCCCCTGCAAACCTGGCACGTATGCAGACAAGCAGGGCTCCTCTTTCTGCAAACTTTGCCCAGCCAACTCTTAT
:   :::::::::::::: :::::::::::::::::::: :::::.:::::::::::::::::::::::::::::::::::::::::::::::: :::::
A---GTGGCCTACACTTCCGAATGCTTCCCCTGCAAACCAGGCACATATGCAGACAAGCAGGGCTCCTCTTTCTGCAAACTTTGCCCAGCCAACACTTAT
-----V--A--Y--T--S--E--C--F--P--C--K--P--G--T--Y--A--D--K--Q--G--S--S--F--C--K--L--C--P--A--N--T--Y-

---------------------------------------------------><-----------------------------------------------
-S--N--K--G--E--T--S--C--H--Q--C--D--P--D--K--Y--S--E--K--G--S--S--S--C--N--V--R--P--A--C--T--D--K--
TCAAATAAAGGAGAAACTTCTTGCCACCAGTGTGACCCTGACAAATACTCAGAGAAAGGATCTTCTTCCTGTAACGTGCGCCCAGCTTGCACAGACAAAG
:: :::::.:::::::::::::::::::::::.::::::::::::::.:::                                                 
TCCAATAAGGGAGAAACTTCTTGCCACCAGTGCGACCCTGACAAATATTCA-------------------------------------------------
-S--N--K--G--E--T--S--C--H--Q--C--D--P--D--K--Y--S--------------------------------------------------

----------------------------------------><----------------------------------------------------------
D--Y--F--Y--T--H--T--A--C--D--A--N--G--E--T--Q--L--M--Y--K--W--A--K--P--K--I--C--S--E--D--L--E--G--A
ATTATTTCTACACACACACGGCCTGCGATGCCAACGGAGAGACACAACTCATGTACAAATGGGCCAAGCCGAAAATCTGTAGCGAGGACCTTGAGGGGGC
                                         ::.::.:::::::::::.:::::: :::::::::::::.::::::::::: ::::::::
-----------------------------------------ACGCAGCTCATGTACAAGTGGGCCCAGCCGAAAATCTGCAGCGAGGACCTGGAGGGGGC
------------------------------------------T--Q--L--M--Y--K--W--A--Q--P--K--I--C--S--E--D--L--E--G--A

----------------------------------------------------------------------------------------------------
--V--K--L--P--A--S--G--V--K--T--H--C--P--P--C--N--P--G--F--F--K--T--N--N--S--T--C--Q--P--C--P--Y--G-
AGTGAAGCTGCCTGCCTCTGGTGTGAAGACCCACTGCCCACCCTGCAACCCAGGCTTCTTCAAAACCAACAACAGCACCTGCCAGCCCTGCCCATATGGT
::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::.:::::::::: :::::::::: :::::.
AGTGAAGCTGCCCGCCTCTGGTGTGAAGACCCACTGCCCACCCTGCAACCCAGGCTTCTTCAAGACCAACAGCAGCACCTGCGAGCCCTGCCCTTATGGC
--V--K--L--P--A--S--G--V--K--T--H--C--P--P--C--N--P--G--F--F--K--T--N--S--S--T--C--E--P--C--P--Y--G-

------------------><--------------------------------------------------------------------------------
-S--Y--S--N--G--S--D--C--T--R--C--P--A--G--T--E--P--A--V--G--F--E--Y--K--W--W--N--T--L--P--T--N--M--
TCCTACTCCAATGGCTCAGACTGTACCCGCTGCCCTGCAGGGACTGAACCTGCTGTGGGATTTGAATACAAATGGTGGAACACGCTGCCCACAAACATGG
:::::::::::.:::      :::: ::.:::::: ::::::::::::::.::.:::::.::::::::::::::::::::::::::::::::.:::::::
TCCTACTCCAACGGC------TGTAGCCACTGCCCAGCAGGGACTGAACCCGCCGTGGGGTTTGAATACAAATGGTGGAACACGCTGCCCACGAACATGG
-S--Y--S--N--G--------C--S--H--C--P--A--G--T--E--P--A--V--G--F--E--Y--K--W--W--N--T--L--P--T--N--M--

-----------------------------------------------><---------------------------------------------------
E--T--T--V--L--S--G--I--N--F--E--Y--K--G--M--T--G--W--E--V--A--G--D--H--I--Y--T--A--A--G--A--S--D--N
AAACGACCGTTCTCAGTGGGATCAACTTCGAGTACAAGGGCATGACAGGCTGGGAGGTGGCTGGTGATCACATTTACACAGCTGCTGGAGCCTCAGACAA
:.::::::::.:::::::::::::::::.::::::::::::::::::   ::::::::::::::.::.::::::::.:::::.:.:::::::::::::::
AGACGACCGTCCTCAGTGGGATCAACTTTGAGTACAAGGGCATGACA---TGGGAGGTGGCTGGCGACCACATTTATACAGCCGTTGGAGCCTCAGACAA
E--T--T--V--L--S--G--I--N--F--E--Y--K--G--M--T-----W--E--V--A--G--D--H--I--Y--T--A--V--G--A--S--D--N

--------------------------------------><------------------------------------------------------------
--D--F--M--I--L--T--L--V--V--P--G--F--R--P--P--Q--S--V--M--A--D--T--E--N--K--E--V--A--R--I--T--F--V-
TGACTTCATGATTCTCACTCTGGTTGTGCCAGGATTTAGACCTCCGCAGTCGGTGATGGCAGACACAGAGAATAAAGAGGTGGCCAGAATCACATTTGTC
:::::::::::::::::::::::: ::::::::::::   : ::: ::::::::::::::::::::.::::::::::::::::::::.::::::::::::
TGACTTCATGATTCTCACTCTGGTGGTGCCAGGATTT---CGTCCCCAGTCGGTGATGGCAGACACGGAGAATAAAGAGGTGGCCAGGATCACATTTGTC
--D--F--M--I--L--T--L--V--V--P--G--F-----R--P--Q--S--V--M--A--D--T--E--N--K--E--V--A--R--I--T--F--V-

--------------------------------------------><------------------------------------------------------
-F--E--T--L--C--S--V--N--C--E--L--Y--F--M--V--G--V--N--S--R--T--N--T--P--V--E--T--W--K--G--S--K--G--
TTTGAGACCCTCTGTTCTGTGAACTGTGAGCTCTACTTCATGGTGGGTGTGAATTCTAGGACCAACACTCCTGTGGAGACGTGGAAAGGTTCCAAAGGCA
:::::::::  ::::::.::::::::::::::::::::::::::::::::::::::::::::::::: ::: :::::::: :::::::::::::::::::
TTTGAGACCGACTGTTCCGTGAACTGTGAGCTCTACTTCATGGTGGGTGTGAATTCTAGGACCAACAGTCCGGTGGAGACCTGGAAAGGTTCCAAAGGCA
-F--E--T--D--C--S--V--N--C--E--L--Y--F--M--V--G--V--N--S--R--T--N--S--P--V--E--T--W--K--G--S--K--G--

----------------------------------------------------------------------------------><----------------
K--Q--S--Y--T--Y--I--I--E--E--N--T--T--T--S--F--T--W--A--F--Q--R--T--T--F--H--E--A--S--R--K--Y--T--N
AACAGTCCTATACCTACATCATTGAGGAGAACACTACCACGAGCTTCACCTGGGCCTTCCAGAGGACCACTTTTCATGAGGCAAGCAGGAAGTACACCAA
::::::::::::::::::::::. :::::::::: ::::.:::::::::::::::::::::::::::::: :.:::::::      ::.:::::::::::
AACAGTCCTATACCTACATCATCCAGGAGAACACAACCATGAGCTTCACCTGGGCCTTCCAGAGGACCACATCTCATGAG------AGAAAGTACACCAA
K--Q--S--Y--T--Y--I--I--Q--E--N--T--T--M--S--F--T--W--A--F--Q--R--T--T--S--H--E--------R--K--Y--T--N

----------------------------------------------------------------------------------------------------
--D--V--A--K--I--Y--S--I--N--V--T--N--V--M--N--G--V--A--S--Y--C--R--P--C--A--L--E--A--S--D--V--G--S-
TGACGTTGCCAAGATCTACTCCATCAATGTCACCAATGTTATGAATGGTGTGGCCTCCTACTGCCGTCCCTGTGCCCTAGAAGCCTCTGATGTGGGCTCC
:::::: :::::::::::::::::::::::::::::.::::::.:::: :::::.::::::::::::::.::::::::.::.::::::::. ::::::::
TGACGTGGCCAAGATCTACTCCATCAATGTCACCAACGTTATGGATGGGGTGGCTTCCTACTGCCGTCCTTGTGCCCTGGAGGCCTCTGACCTGGGCTCC
--D--V--A--K--I--Y--S--I--N--V--T--N--V--M--D--G--V--A--S--Y--C--R--P--C--A--L--E--A--S--D--L--G--S-

----------------------------------------------------------------------------------------------------
-S--C--T--S--C--P--A--G--Y--Y--I--D--R--D--S--G--T--C--H--S--C--P--T--N--T--I--L--K--A--H--Q--P--Y--
TCCTGCACCTCTTGTCCTGCTGGTTACTATATTGACCGAGATTCAGGAACCTGCCACTCCTGCCCCACTAACACAATTCTGAAAGCCCACCAGCCTTATG
::.:::::::::::.:::::.::.:::::::::::.::.::::::::::::::::::::::::::  ::::::::::.::::::::::::::::::::.:
TCTTGCACCTCTTGCCCTGCCGGCTACTATATTGATCGGGATTCAGGAACCTGCCACTCCTGCCCGCCTAACACAATCCTGAAAGCCCACCAGCCTTACG
-S--C--T--S--C--P--A--G--Y--Y--I--D--R--D--S--G--T--C--H--S--C--P--P--N--T--I--L--K--A--H--Q--P--Y--

----------------------------------------------><----------------------------------------------------
G--V--Q--A--C--V--P--C--G--P--G--T--K--N--N--K--I--H--S--L--C--Y--N--D--C--T--F--S--R--N--T--P--T--R
GTGTCCAGGCCTGTGTGCCCTGTGGTCCAGGGACCAAGAACAACAAGATCCACTCTCTGTGCTACAACGATTGCACCTTCTCACGCAACACTCCGACCAG
:.:.:::.:::::..:.: ::::::::::::::::::::.:::::::::::::::::::::::::::.:::::.:::::::::  ::::::: ::::: :
GCGCCCAAGCCTGCATACGCTGTGGTCCAGGGACCAAGAGCAACAAGATCCACTCTCTGTGCTACAATGATTGTACCTTCTCAGTCAACACTACGACCCG
G--A--Q--A--C--I--R--C--G--P--G--T--K--S--N--K--I--H--S--L--C--Y--N--D--C--T--F--S--V--N--T--T--T--R

----------------------------------------------------------------------------------------------------
--T--F--N--Y--N--F--S--A--L--A--N--T--V--T--L--A--G--G--P--S--F--T--S--K--G--L--K--Y--F--H--H--F--T-
GACTTTCAACTACAACTTCTCCGCTTTGGCAAACACTGTCACTCTTGCTGGAGGGCCAAGCTTCACTTCCAAAGGGCTGAAATACTTCCATCACTTTACC
::::::..::::::::::::. ::::::: :::::::::: :::: :::::::::::.::::::::::::::::::.::::.::.:::::.:::::::::
GACTTTTGACTACAACTTCTTGGCTTTGGGAAACACTGTCTCTCTGGCTGGAGGGCCGAGCTTCACTTCCAAAGGGTTGAAGTATTTCCACCACTTTACC
--T--F--D--Y--N--F--L--A--L--G--N--T--V--S--L--A--G--G--P--S--F--T--S--K--G--L--K--Y--F--H--H--F--T-

--------------------><------------------------------------------------------------------------------
-L--S--L--C--G--N--Q--G--R--K--M--S--V--C--T--D--N--V--T--D--L--R--I--P--E--G--E--S--G--F--S--K--S--
CTCAGTCTCTGTGGAAACCAGGGTAGGAAAATGTCTGTGTGCACCGACAATGTCACTGACCTCCGGATTCCTGAGGGTGAGTCAGGGTTCTCCAAATCTA
:::::::::::.:::::::::                                                                               
CTCAGTCTCTGCGGAAACCAG-------------------------------------------------------------------------------
-L--S--L--C--G--N--Q--------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
I--T--A--Y--V--C--Q--A--V--I--I--P--P--E--V--T--G--Y--K--A--G--V--S--S--Q--P--V--S--L--A--D--R--L--I
TCACAGCCTACGTCTGCCAGGCAGTCATCATCCCCCCAGAGGTGACAGGCTACAAGGCCGGGGTTTCCTCACAGCCTGTCAGCCTTGCTGATCGACTTAT
     ::::::.:::::::::::::::::::.:::.:.:::::::::::::::::::::::.:: :::::.::::::::::::::.::.::::::::.  
-----GCCTACATCTGCCAGGCAGTCATCATTCCCTCGGAGGTGACAGGCTACAAGGCCGGAGTGTCCTCGCAGCCTGTCAGCCTCGCCGATCGACTC--
------A--Y--I--C--Q--A--V--I--I--P--S--E--V--T--G--Y--K--A--G--V--S--S--Q--P--V--S--L--A--D--R--L---

-><-----------------------------------------------------------------------------------------------><
--G--V--T--T--D--M--T--L--D--G--I--T--S--P--A--E--L--F--H--L--E--S--L--G--I--P--D--V--I--F--F--Y--R-
TGGGGTGACAACAGATATGACTCTGGATGGAATCACCTCCCCAGCTGAACTTTTCCACCTGGAGTCCTTGGGAATACCGGACGTGATCTTCTTTTATAGG
    :::::::::: ::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::   
----GTGACAACAGCTATGACTCTGGATGGAATCACCTCCCCAGCTGAACTTTTCCACCCGGAGTCCTTGGGAATACCGGACGTGATCTTCTTTTAT---
-----V--T--T--A--M--T--L--D--G--I--T--S--P--A--E--L--F--H--P--E--S--L--G--I--P--D--V--I--F--F--Y----

----------------------------------------------------------------------------------------------------
-S--N--D--V--T--Q--S--C--S--S--G--R--S--T--T--I--R--V--R--C--S--P--Q--K--T--V--P--G--S--L--L--L--P--
TCCAATGATGTGACCCAGTCCTGCAGTTCTGGGAGATCAACCACCATCCGCGTCAGGTGCAGTCCACAGAAAACTGTCCCTGGAAGTTTGCTGCTGCCAG
::::::::::::::::::::::::::::::::::::::::::::::::::: ::::.:::::::: : :::: :::..:::::::::.::::::::::: 
TCCAATGATGTGACCCAGTCCTGCAGTTCTGGGAGATCAACCACCATCCGCCTCAGATGCAGTCCCCTGAAACCTGCTCCTGGAAGTCTGCTGCTGCCA-
-S--N--D--V--T--Q--S--C--S--S--G--R--S--T--T--I--R--L--R--C--S--P--L--K--P--A--P--G--S--L--L--L--P--

><--------------------------------------------------------------------------------------------------
G--T--C--S--D--G--T--C--D--G--C--N--F--H--F--L--W--E--S--A--A--A--C--P--L--C--S--V--A--D--Y--H--A--I
GAACGTGCTCGGATGGGACCTGTGATGGCTGCAACTTCCACTTCCTGTGGGAGAGCGCGGCTGCTTGCCCGCTCTGCTCAGTGGCTGACTACCATGCTAT
  ::.::::: ::::::::::::::.:::::.:::::::::::::::::::::::::.:::.:::::::::::::::::::. ::.:::::::::.:.::
--ACATGCTCCGATGGGACCTGTGACGGCTGTAACTTCCACTTCCTGTGGGAGAGCGTGGCCGCTTGCCCGCTCTGCTCAGCTGCCGACTACCATACCAT
---T--C--S--D--G--T--C--D--G--C--N--F--H--F--L--W--E--S--V--A--A--C--P--L--C--S--A--A--D--Y--H--T--I

---------------------------><-----------------------------------------------------------------------
--V--S--S--C--V--A--G--I--Q--K--T--T--Y--V--W--R--E--P--K--L--C--S--G--G--I--S--L--P--E--Q--R--V--T-
CGTCAGCAGCTGTGTGGCTGGGATCCAGAAGACTACTTACGTGTGGCGAGAACCCAAGCTATGCTCTGGTGGCATTTCTCTGCCTGAGCAGAGAGTCACC
::::::.:::::....::.::::::::::::::.:::::::::::::: ::::: :::::.::::: ::::::::.::.:::::::::::::::::::::
CGTCAGTAGCTGCACAGCCGGGATCCAGAAGACCACTTACGTGTGGCGTGAACCAAAGCTGTGCTCGGGTGGCATCTCCCTGCCTGAGCAGAGAGTCACC
--V--S--S--C--T--A--G--I--Q--K--T--T--Y--V--W--R--E--P--K--L--C--S--G--G--I--S--L--P--E--Q--R--V--T-

----------------------------------------------------------------------------------------------------
-I--C--K--T--I--D--F--W--L--K--V--G--I--S--A--G--T--C--T--A--I--L--L--T--V--L--T--C--Y--F--W--K--K--
ATCTGCAAAACCATAGATTTCTGGCTGAAAGTGGGCATCTCTGCAGGCACCTGTACTGCCATCCTGCTCACCGTCTTGACCTGCTACTTTTGGAAAAAGA
::::::::::: :::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::.::::::::::
ATCTGCAAAACGATAGACTTCTGGCTGAAAGTGGGCATCTCTGCAGGCACCTGTACTGCCATCCTGCTCACCGTCTTGACCTGTTACTTCTGGAAAAAGA
-I--C--K--T--I--D--F--W--L--K--V--G--I--S--A--G--T--C--T--A--I--L--L--T--V--L--T--C--Y--F--W--K--K--

------><--------------------------------------------------------------------------------------------
N--Q--K--L--E--Y--K--Y--S--K--L--V--M--N--A--T--L--K--D--C--D--L--P--A--A--D--S--C--A--I--M--E--G--E
ATCAAAAACTAGAGTACAAGTACTCCAAGCTGGTGATGAATGCTACTCTCAAGGACTGTGACCTGCCAGCAGCTGACAGCTGCGCCATCATGGAAGGCGA
:::.:                                                   ::::::::::::::::::::::::::.:::::::::::::::::
ATCGA---------------------------------------------------TGTGACCTGCCAGCAGCTGACAGCTGTGCCATCATGGAAGGCGA
N--R-----------------------------------------------------C--D--L--P--A--A--D--S--C--A--I--M--E--G--E

------------------------------------------------------------------------><--------------------------
--D--V--E--D--D--L--I--F--T--S--K--K--S--L--F--G--K--I--K--S--F--T--S--K--R--T--P--D--G--F--D--S--V-
GGATGTAGAGGACGACCTCATCTTTACCAGCAAGAAGTCACTCTTTGGGAAGATCAAATCATTTACCTCCAAGAGGACTCCTGATGGATTTGACTCAGTG
:::.::.:::::::::::.:::::.:::::::::::::::::.::::: :::::::.:::.:::::::::::::.:::::::::::::::::::::.:::
GGACGTGGAGGACGACCTTATCTTCACCAGCAAGAAGTCACTTTTTGGCAAGATCAGATCGTTTACCTCCAAGAAGACTCCTGATGGATTTGACTCGGTG
--D--V--E--D--D--L--I--F--T--S--K--K--S--L--F--G--K--I--R--S--F--T--S--K--K--T--P--D--G--F--D--S--V-

----------------------------------------->
-P--L--K--T--S--S--G--G--L--D--M--D--L--*-
CCGCTGAAGACATCCTCAGGAGGCCTAGACATGGACCTGTGA
::.:::::::: :: ::::::::::.::::::::::::::::
CCACTGAAGACCTCGTCAGGAGGCCCAGACATGGACCTGTGA
-P--L--K--T--S--S--G--G--P--D--M--D--L--*-

Pig Consensus Sequence

>BGISUST0000886600
ATGGCTGAGCCTGGGCACAGCCTCCATCCCTCTGCCAGAGGCAGGGGAAGAACTGAGCGGCGCACACTCCGGCTTCTGCGGCTGCTGCTCTGGGTTGGGA
CCGCCTTCCAGGTGACTCAGGGAGCGGGACTGGAGCTTCACGCCTGCAAAGAGTCTGAGTACCACTACGAATACACTGCGTGTGACAGCACGGGTTCCAG
GTGGAGAGTCGCCGTGCCACACACCCCAGGCCTGTGCACCAGCCTCCCTGACCCAGTCAAGGGCACCGAGTGC---TTCTCTTGCAAAGCCGGGGAGTTT
CTGGACATGAAGGACCAGTCGTGTAAGCCGTGCGCTGAGGGCCGCTACTCCCTTGGCACAGGCATCCGGTTCGACGAATGGGATGAGCTGCCCCATGGCT
TTGCCAGCCTCTCAACCAACATGGAGATTGAAGACAGCACCATTGGGTCCACCGGGAACTGCACT---TCCAAGTGGGTTCCTCTGGGCGACTACATCTC
CTCCAACACGGATGAGTGCACAGCCACGCTGATGTACGCCGTCAACCTGAAGCAGTCTGGCACCGTTAACTTTGAGTACTACTACCCAGATTCTAGCATC
ATCTTCGAG------GTTCAGAATGACCAGTGCCAGCCCAATGCAGATGACTCCAGGTGGATGAAAACCACAGAGAAAGGATGGGAATTCCAC---GTGG
AGCTAAATCGAGGCAATAACGTCCTCTATTGGAGAACCACTGCCTTCTCGGTGTGGTCCAAAGTTTCCAAGCCTGTGCTGGTGCGAAACATCGCCATAAC
A---GTGGCCTACACTTCCGAATGCTTCCCCTGCAAACCAGGCACATATGCAGACAAGCAGGGCTCCTCTTTCTGCAAACTTTGCCCAGCCAACACTTAT
TCCAATAAGGGAGAAACTTCTTGCCACCAGTGCGACCCTGACAAATATTCA-------------------------------------------------
-----------------------------------------ACGCAGCTCATGTACAAGTGGGCCCAGCCGAAAATCTGCAGCGAGGACCTGGAGGGGGC
AGTGAAGCTGCCCGCCTCTGGTGTGAAGACCCACTGCCCACCCTGCAACCCAGGCTTCTTCAAGACCAACAGCAGCACCTGCGAGCCCTGCCCTTATGGC
TCCTACTCCAACGGC------TGTAGCCACTGCCCAGCAGGGACTGAACCCGCCGTGGGGTTTGAATACAAATGGTGGAACACGCTGCCCACGAACATGG
AGACGACCGTCCTCAGTGGGATCAACTTTGAGTACAAGGGCATGACA---TGGGAGGTGGCTGGCGACCACATTTATACAGCCGTTGGAGCCTCAGACAA
TGACTTCATGATTCTCACTCTGGTGGTGCCAGGATTT---CGTCCCCAGTCGGTGATGGCAGACACGGAGAATAAAGAGGTGGCCAGGATCACATTTGTC
TTTGAGACCGACTGTTCCGTGAACTGTGAGCTCTACTTCATGGTGGGTGTGAATTCTAGGACCAACAGTCCGGTGGAGACCTGGAAAGGTTCCAAAGGCA
AACAGTCCTATACCTACATCATCCAGGAGAACACAACCATGAGCTTCACCTGGGCCTTCCAGAGGACCACATCTCATGAG------AGAAAGTACACCAA
TGACGTGGCCAAGATCTACTCCATCAATGTCACCAACGTTATGGATGGGGTGGCTTCCTACTGCCGTCCTTGTGCCCTGGAGGCCTCTGACCTGGGCTCC
TCTTGCACCTCTTGCCCTGCCGGCTACTATATTGATCGGGATTCAGGAACCTGCCACTCCTGCCCGCCTAACACAATCCTGAAAGCCCACCAGCCTTACG
GCGCCCAAGCCTGCATACGCTGTGGTCCAGGGACCAAGAGCAACAAGATCCACTCTCTGTGCTACAATGATTGTACCTTCTCAGTCAACACTACGACCCG
GACTTTTGACTACAACTTCTTGGCTTTGGGAAACACTGTCTCTCTGGCTGGAGGGCCGAGCTTCACTTCCAAAGGGTTGAAGTATTTCCACCACTTTACC
CTCAGTCTCTGCGGAAACCAG-------------------------------------------------------------------------------
-----GCCTACATCTGCCAGGCAGTCATCATTCCCTCGGAGGTGACAGGCTACAAGGCCGGAGTGTCCTCGCAGCCTGTCAGCCTCGCCGATCGACTC--
----GTGACAACAGCTATGACTCTGGATGGAATCACCTCCCCAGCTGAACTTTTCCACCCGGAGTCCTTGGGAATACCGGACGTGATCTTCTTTTAT---
TCCAATGATGTGACCCAGTCCTGCAGTTCTGGGAGATCAACCACCATCCGCCTCAGATGCAGTCCCCTGAAACCTGCTCCTGGAAGTCTGCTGCTGCCA-
--ACATGCTCCGATGGGACCTGTGACGGCTGTAACTTCCACTTCCTGTGGGAGAGCGTGGCCGCTTGCCCGCTCTGCTCAGCTGCCGACTACCATACCAT
CGTCAGTAGCTGCACAGCCGGGATCCAGAAGACCACTTACGTGTGGCGTGAACCAAAGCTGTGCTCGGGTGGCATCTCCCTGCCTGAGCAGAGAGTCACC
ATCTGCAAAACGATAGACTTCTGGCTGAAAGTGGGCATCTCTGCAGGCACCTGTACTGCCATCCTGCTCACCGTCTTGACCTGTTACTTCTGGAAAAAGA
ATCGA---------------------------------------------------TGTGACCTGCCAGCAGCTGACAGCTGTGCCATCATGGAAGGCGA
GGACGTGGAGGACGACCTTATCTTCACCAGCAAGAAGTCACTTTTTGGCAAGATCAGATCGTTTACCTCCAAGAAGACTCCTGATGGATTTGACTCGGTG
CCACTGAAGACCTCGTCAGGAGGCCCAGACATGGACCTGTGA


>BGISUSP0000886600
MAEPGHSLHPSARGRGRTERRTLRLLRLLLWVGTAFQVTQGAGLELHACKESEYHYEYTACDSTGSRWRVAVPHTPGLCTSLPDPVKGTEC-FSCKAGEF
LDMKDQSCKPCAEGRYSLGTGIRFDEWDELPHGFASLSTNMEIEDSTIGSTGNCT-SKWVPLGDYISSNTDECTATLMYAVNLKQSGTVNFEYYYPDSSI
IFE--VQNDQCQPNADDSRWMKTTEKGWEFH-VELNRGNNVLYWRTTAFSVWSKVSKPVLVRNIAIT-VAYTSECFPCKPGTYADKQGSSFCKLCPANTY
SNKGETSCHQCDPDKYS------------------------------TQLMYKWAQPKICSEDLEGAVKLPASGVKTHCPPCNPGFFKTNSSTCEPCPYG
SYSNG--CSHCPAGTEPAVGFEYKWWNTLPTNMETTVLSGINFEYKGMT-WEVAGDHIYTAVGASDNDFMILTLVVPGF-RPQSVMADTENKEVARITFV
FETDCSVNCELYFMVGVNSRTNSPVETWKGSKGKQSYTYIIQENTTMSFTWAFQRTTSHE--RKYTNDVAKIYSINVTNVMDGVASYCRPCALEASDLGS
SCTSCPAGYYIDRDSGTCHSCPPNTILKAHQPYGAQACIRCGPGTKSNKIHSLCYNDCTFSVNTTTRTFDYNFLALGNTVSLAGGPSFTSKGLKYFHHFT
LSLCGNQ----------------------------AYICQAVIIPSEVTGYKAGVSSQPVSLADRL--VTTAMTLDGITSPAELFHPESLGIPDVIFFY-
SNDVTQSCSSGRSTTIRLRCSPLKPAPGSLLLP-TCSDGTCDGCNFHFLWESVAACPLCSAADYHTIVSSCTAGIQKTTYVWREPKLCSGGISLPEQRVT
ICKTIDFWLKVGISAGTCTAILLTVLTCYFWKKNR-----------------CDLPAADSCAIMEGEDVEDDLIFTSKKSLFGKIRSFTSKKTPDGFDSV
PLKTSSGGPDMDL*