Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000116731 (click for geneview)
Transcript ID ENST00000235372(link to ensembl)
Symbol PRDM2
Localtion Chromosome:1:13776656:13896881:1 band: 1p36.21
Description PR-domain zinc finger protein 2 (Retinoblastoma protein-interacting zinc-finger protein) (Zinc finger protein RIZ) (MTE-binding protein) (MTB-ZF) (GATA-3 binding protein G3B). [Source:Uniprot/SWISSPROT;Acc:Q13029]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-------><------------------------------------------------------------------------------------------
-M--N--Q--N--T--T--E--P--V--A--A--T--E--T--L--A--E--V--P--E--H--V--L--R--G--L--P--E--E--V--R--L--F--
ATGAATCAGAACACTACTGAGCCTGTGGCGGCCACCGAGACCCTGGCTGAGGTACCCGAACATGTGCTGCGAGGACTTCCGGAGGAAGTGAGGCTTTTCC
         :::.: .:::::::::::::.:::.:::::::::::::.:::::.::.::::::::::: :::::::::::::::::::::::::::::::
---------AACGCAGCTGAGCCTGTGGCAGCCGCCGAGACCCTGGCCGAGGTGCCTGAACATGTGCTTCGAGGACTTCCGGAGGAAGTGAGGCTTTTCC
----------N--A--A--E--P--V--A--A--A--E--T--L--A--E--V--P--E--H--V--L--R--G--L--P--E--E--V--R--L--F--

--------------------------><------------------------------------------------------------------------
P--S--A--V--D--K--T--R--I--G--V--W--A--T--K--P--I--L--K--G--K--K--F--G--P--F--V--G--D--K--K--K--R--S
CTTCTGCTGTTGACAAGACCCGGATTGGTGTCTGGGCCACTAAACCAATTTTAAAAGGCAAAAAATTTGGGCCATTTGTTGGTGATAAGAAAAAAAGATC
: :::::::::::::::::.::::::   :::::::::::::::::::::::::::::::::::.::::::::::::::.:::::::::::::::::.::
CATCTGCTGTTGACAAGACTCGGATT---GTCTGGGCCACTAAACCAATTTTAAAAGGCAAAAAGTTTGGGCCATTTGTCGGTGATAAGAAAAAAAGGTC
P--S--A--V--D--K--T--R--I-----V--W--A--T--K--P--I--L--K--G--K--K--F--G--P--F--V--G--D--K--K--K--R--S

------------------------------><--------------------------------------------------------------------
--Q--V--K--N--N--V--Y--M--W--E--V--Y--Y--P--N--L--G--W--M--C--I--D--A--T--D--P--E--K--G--N--W--L--R-
TCAGGTTAAGAATAATGTATACATGTGGGAGGTGTATTACCCAAATTTGGGATGGATGTGCATTGATGCCACTGATCCAGAGAAGGGAAACTGGCTGCGA
:::::::::::::::::::::::::::::::                                                                     
TCAGGTTAAGAATAATGTATACATGTGGGAG---------------------------------------------------------------------
--Q--V--K--N--N--V--Y--M--W--E----------------------------------------------------------------------

-----------------------------------------------------------------------------------><---------------
-Y--V--N--W--A--C--S--G--E--E--Q--N--L--F--P--L--E--I--N--R--A--I--Y--Y--K--T--L--K--P--I--A--P--G--
TATGTGAATTGGGCTTGCTCAGGAGAAGAGCAAAATTTATTCCCACTGGAAATCAACAGAGCCATTTACTATAAAACTTTAAAGCCAATCGCGCCGGGCG
                                                                                    ::::::::::::::::
------------------------------------------------------------------------------------CCAATCGCGCCGGGCG
-------------------------------------------------------------------------------------P--I--A--P--G--

----------------------------------------------------------------------------------------------------
E--E--L--L--V--W--Y-----N--G--E--D--N--P--E--I--A--A--A--I--E--E--E--R--A--S--A--R--S--K--R--S--S--P
AGGAGCTCCTGGTCTGGTAC---AATGGGGAAGACAACCCTGAGATAGCAGCTGCGATTGAGGAAGAGCGAGCCAGCGCCCGGAGCAAGCGGAGCTCCCC
::::::::::::::::::::   :::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
AGGAGCTCCTGGTCTGGTACC--AATGGGGAAGACAACCCCGAGATAGCAGCTGCGATTGAGGAAGAGCGAGCCAGCGCCCGGAGCAAGCGGAGCTCCCC
E--E--L--L--V--W--Y--\--N--G--E--D--N--P--E--I--A--A--A--I--E--E--E--R--A--S--A--R--S--K--R--S--S--P

-------------><-------------------------------------------------------------------------------------
--K--S--R--K--G--K--K--K--S--Q--E--N--K--N--K--G--N--K--I--Q--D--I--Q--L--K--T--S--E--P--D--F--T--S-
CAAGAGCCGGAAAGGGAAGAAAAAATCCCAGGAAAATAAAAACAAAGGAAACAAAATCCAAGACATACAACTGAAGACAAGTGAGCCAGATTTCACCTCT
 ::.::: :::::                                                ::.:.::::::::::::::::::::::::::.:: ::::
GAAAAGCAGGAAA------------------------------------------------GATACACAACTGAAGACAAGTGAGCCAGATTCCAGCTCT
--K--S--R--K--------------------------------------------------D--T--Q--L--K--T--S--E--P--D--S--S--S-

------------------------><--------------------------------------------------------------------------
-A--N--M--R--D--S--A--E--G--P--K--E--D--E--E--K--P--S--A--S--A--L--E--Q--P--A--T--L--Q--E--V--A--S--
GCAAATATGAGAGATTCTGCAGAAGGTCCTAAAGAAGACGAAGAGAAGCCTTCAGCCTCAGCACTTGAGCAGCCGGCCACCCTCCAGGAGGTGGCCAGTC
::::::::::::::::::::.:::                                                                            
GCAAATATGAGAGATTCTGCGGAA----------------------------------------------------------------------------
-A--N--M--R--D--S--A--E-----------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
Q--E--V--P--P--E--L--A--T--P--A--P--A--W--E--P--Q--P--E--P--D--E--R--L--E--A--A--A--C--E--V--N--D--L
AGGAGGTGCCTCCAGAACTAGCAACCCCTGCCCCTGCCTGGGAGCCACAGCCAGAACCAGACGAGCGATTAGAAGCGGCAGCTTGTGAGGTGAATGATTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--G--E--E--E--E--E--E--E--E--E--D--E--E--E--E--E--D--D--D--D--D--E--L--E--D--E--G--E--E--E--A--S--M-
GGGGGAAGAGGAGGAGGAGGAAGAGGAGGAGGATGAAGAAGAAGAAGAAGATGATGATGATGATGAGTTGGAAGACGAGGGGGAAGAAGAAGCCAGCATG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-P--N--E--N--S--V--K--E--P--E--I--R--C--D--E--K--P--E--D--L--L--E--E--P--K--T--T--S--E--E--T--L--E--
CCAAATGAAAATTCTGTGAAAGAGCCAGAAATACGGTGTGATGAGAAGCCAGAAGATTTATTAGAGGAACCAAAAACAACTTCAGAAGAAACTCTTGAAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
D--C--S--E--V--T--P--A--M--Q--I--P--R--T--K--E--E--A--N--G--D--V--F--E--T--F--M--F--P--C--Q--H--C--E
ACTGCTCAGAGGTAACACCTGCCATGCAAATCCCCAGAACTAAAGAAGAGGCCAATGGTGATGTATTTGAAACGTTTATGTTTCCGTGTCAACATTGTGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--R--K--F--T--T--K--Q--G--L--E--R--H--M--H--I--H--I--S--T--V--N--H--A--F--K--C--K--Y--C--G--K--A--F-
AAGGAAGTTTACAACCAAACAGGGGCTTGAGCGTCACATGCATATCCATATATCCACCGTCAATCATGCTTTCAAATGCAAGTACTGTGGGAAAGCCTTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-G--T--Q--I--N--R--R--R--H--E--R--R--H--E--A--G--L--K--R--K--P--S--Q--T--L--Q--P--S--E--D--L--A--D--
GGCACACAGATTAACCGGCGGCGACATGAGCGGCGCCATGAAGCAGGGTTAAAGCGGAAACCCAGCCAAACACTACAGCCGTCAGAGGATCTGGCTGATG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
G--K--A--S--G--E--N--V--A--S--K--D--D--S--S--P--P--S--L--G--P--D--C--L--I--M--N--S--E--K--A--S--Q--D
GCAAAGCATCTGGAGAAAACGTTGCTTCAAAAGATGATTCGAGTCCTCCCAGTCTTGGGCCAGACTGTCTGATCATGAATTCAGAGAAGGCTTCCCAAGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--T--I--N--S--S--V--V--E--E--N--G--E--V--K--E--L--H--P--C--K--Y--C--K--K--V--F--G--T--H--T--N--M--R-
CACAATAAATTCTTCTGTCGTAGAAGAGAATGGGGAAGTTAAAGAACTTCATCCGTGCAAATATTGTAAAAAGGTTTTTGGAACTCATACTAATATGAGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-R--H--Q--R--R--V--H--E--R--H--L--I--P--K--G--V--R--R--K--G--G--L--E--E--P--Q--P--P--A--E--Q--A--Q--
CGGCATCAGCGTAGAGTTCACGAACGTCATCTGATTCCCAAAGGTGTACGGCGAAAAGGAGGCCTTGAAGAGCCCCAGCCTCCAGCAGAACAGGCCCAGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
A--T--Q--N--V--Y--V--P--S--T--E--P--E--E--E--G--E--A--D--D--V--Y--I--M--D--I--S--S--N--I--S--E--N--L
CCACCCAGAACGTGTATGTACCAAGCACAGAGCCGGAGGAGGAAGGGGAAGCAGATGATGTGTACATCATGGACATTTCTAGCAATATCTCTGAAAACTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--N--Y--Y--I--D--G--K--I--Q--T--N--N--N--T--S--N--C--D--V--I--E--M--E--S--A--S--A--D--L--Y--G--I--N-
AAATTACTATATTGATGGTAAAATTCAAACTAATAACAACACTAGTAACTGTGATGTGATTGAGATGGAGTCTGCTTCGGCAGATTTGTATGGTATAAAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-C--L--L--T--P--V--T--V--E--I--T--Q--N--I--K--T--T--Q--V--P--V--T--E--D--L--P--K--E--P--L--G--S--T--
TGTCTGCTCACTCCAGTTACAGTGGAAATTACTCAAAATATAAAGACCACACAGGTCCCTGTAACAGAAGATCTTCCTAAAGAGCCTTTGGGCAGCACAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
N--S--E--A--K--K--R--R--T--A--S--P--P--A--L--P--K--I--K--A--E--T--D--S--D--P--M--V--P--S--C--S--L--S
ATAGTGAGGCCAAGAAGCGGAGAACTGCGAGCCCACCTGCACTGCCCAAAATTAAGGCCGAAACAGACTCTGACCCCATGGTCCCCTCTTGCTCTTTAAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--L--P--L--S--I--S--T--T--E--A--V--S--F--H--K--E--K--S--V--Y--L--S--S--K--L--K--Q--L--L--Q--T--Q--D-
TCTTCCTCTTAGCATATCAACAACAGAGGCAGTGTCTTTCCACAAAGAGAAAAGTGTTTATTTGTCATCAAAGCTCAAACAACTTCTTCAAACCCAAGAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-K--L--T--P--A--G--I--S--A--T--E--I--A--K--L--G--P--V--C--V--S--A--P--A--S--M--L--P--V--T--S--S--R--
AAACTAACTCCTGCAGGGATTTCAGCAACTGAAATAGCTAAATTAGGTCCTGTTTGTGTGTCTGCTCCTGCATCAATGTTGCCTGTGACCTCAAGTAGGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
F--K--R--R--T--S--S--P--P--S--S--P--Q--H--S--P--A--L--R--D--F--G--K--P--S--D--G--K--A--A--W--T--D--A
TTAAGAGGCGGACCAGCTCTCCTCCCAGTTCTCCACAGCACAGTCCTGCCCTTCGAGACTTTGGAAAGCCAAGTGATGGGAAAGCAGCATGGACCGATGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--G--L--T--S--K--K--S--K--L--E--S--H--S--D--S--P--A--W--S--L--S--G--R--D--E--R--E--T--V--S--P--P--C-
CGGGCTGACTTCCAAAAAATCCAAATTAGAAAGTCACAGCGACTCACCAGCATGGAGTTTGTCTGGGAGAGATGAGAGAGAAACTGTGAGCCCTCCATGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-F--D--E--Y--K--M--S--K--E--W--T--A--S--S--A--F--S--S--V--C--N--Q--Q--P--L--D--L--S--S--G--V--K--Q--
TTTGATGAATATAAAATGTCTAAAGAGTGGACAGCTAGTTCTGCTTTTAGCAGTGTGTGCAACCAGCAGCCACTGGATTTATCCAGCGGTGTCAAACAGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
K--A--E--G--T--G--K--T--P--V--Q--W--E--S--V--L--D--L--S--V--H--K--K--H--C--S--D--S--E--G--K--E--F--K
AGGCTGAGGGTACAGGCAAGACTCCAGTCCAGTGGGAATCTGTCTTAGATCTCAGTGTGCATAAAAAGCATTGTAGTGACTCTGAAGGCAAGGAATTCAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--E--S--H--S--V--Q--P--T--C--S--A--V--K--K--R--K--P--T--T--C--M--L--Q--K--V--L--L--N--E--Y--N--G--I-
AGAAAGTCATTCAGTGCAGCCTACGTGTAGTGCTGTAAAGAAAAGGAAACCAACCACCTGCATGCTGCAGAAGGTTCTTCTCAATGAATATAATGGCATC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-D--L--P--V--E--N--P--A--D--G--T--R--S--P--S--P--C--K--S--L--E--A--Q--P--D--P--D--L--G--P--G--S--G--
GATTTACCTGTAGAAAACCCTGCAGATGGGACCAGGAGCCCAAGTCCTTGTAAATCCCTAGAAGCTCAGCCAGATCCTGACCTCGGTCCGGGCTCTGGTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
F--P--A--P--T--V--E--S--T--P--D--V--C--P--S--S--P--A--L--Q--T--P--S--L--S--S--G--Q--L--P--P--L--L--I
TCCCTGCCCCTACTGTTGAGTCCACACCTGATGTTTGTCCTTCATCACCTGCCCTGCAGACACCCTCCCTTTCATCCGGTCAGCTGCCTCCTCTCTTGAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--P--T--D--P--S--S--P--P--P--C--P--P--V--L--T--V--A--T--P--P--P--P--L--L--P--T--V--P--L--P--A--P--S-
CCCCACAGATCCCTCTTCCCCTCCACCCTGTCCCCCGGTATTAACTGTTGCCACTCCGCCCCCTCCCCTCCTTCCTACCGTACCTCTTCCAGCCCCCTCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-S--S--A--S--P--H--P--C--P--S--P--L--S--N--A--T--A--Q--S--P--L--P--I--L--S--P--T--V--S--P--S--P--S--
TCCAGTGCATCTCCACACCCATGCCCCTCTCCACTCTCAAATGCCACCGCACAGTCCCCACTTCCAATTCTGTCCCCAACAGTGTCCCCCTCTCCCTCTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
P--I--P--P--V--E--P--L--M--S--A--A--S--P--G--P--P--T--L--S--S--S--S--S--S--S--S--S--S--S--S--F--S--S
CCATTCCTCCCGTGGAGCCCCTGATGTCTGCCGCCTCACCCGGGCCTCCAACACTTTCTTCTTCCTCCTCTTCATCTTCCTCCTCCTCTTCGTTTTCTTC
                                                                 :::.:: : ::.: :::..::::::: ::.:::::
-----------------------------------------------------------------TCCCCTGCTTCCTACTCTCCCTCTTCCTTCTCTTC
------------------------------------------------------------------S--P--A--S--Y--S--P--S--S--F--S--S

----------------------------------------------------------------------------------------------------
--S--S--S--S--S--S--P--S--P--P--P--L--S--A--I--S--S--V--V--S--S--G--D--N--L--E--A--S--L--P--M--I--S-
TTCATCTTCCTCCTCTTCTCCTTCTCCACCTCCTCTCTCCGCAATATCATCTGTTGTTTCCTCTGGTGATAATCTGGAGGCTTCTCTCCCCATGATATCT
 ::.:: ::::::::.::.::.:: ::::::::.:::::::::.: :: ::.:: :: ::::: :: :::::.:::::.::.:::::::::::::: :::
GTCGTCGTCCTCCTCCTCCCCCTCACCACCTCCCCTCTCCGCAGTCTCCTCCGTGGTGTCCTCAGGGGATAACCTGGAAGCCTCTCTCCCCATGATCTCT
--S--S--S--S--S--S--P--S--P--P--P--L--S--A--V--S--S--V--V--S--S--G--D--N--L--E--A--S--L--P--M--I--S-

----------------------------------------------------------------------------------------------------
-F--K--Q--E--E--L--E--N--E--G--L--K--P--R--E--E--P--Q--S--A--A--E--Q--D--V--V--V--Q--E--T--F--N--K--
TTCAAACAGGAGGAATTAGAGAATGAAGGTCTGAAACCCAGGGAAGAGCCCCAGTCTGCTGCTGAACAGGATGTTGTTGTTCAGGAAACATTCAACAAAA
:::::.::::::::.::::::::.::.:.::::::: ::::::::::. ::::: ::::.:: ::.:.:   :.:::.::::::::.:::::::::::::
TTCAAGCAGGAGGAGTTAGAGAACGAGGATCTGAAAGCCAGGGAAGAAGCCCAGGCTGCCGCGGAGCGG---GCTGTCGTTCAGGAGACATTCAACAAAA
-F--K--Q--E--E--L--E--N--E--D--L--K--A--R--E--E--A--Q--A--A--A--E--R-----A--V--V--Q--E--T--F--N--K--

----------------------------------------------------------------------------------------------------
N--F--V--C--N--V--C--E--S--P--F--L--S--I--K--D--L--T--K--H--L--S--I--H--A--E--E--W--P--F--K--C--E--F
ACTTTGTTTGCAACGTCTGTGAATCACCTTTTCTTTCCATTAAAGATCTAACCAAACATTTATCTATTCATGCTGAAGAATGGCCCTTCAAATGTGAATT
:::::::.:::::::::::::::::.::::::::::::::::::::::::::::::::::::::..::::::::::::: ::::::::::::::::::::
ACTTTGTCTGCAACGTCTGTGAATCGCCTTTTCTTTCCATTAAAGATCTAACCAAACATTTATCCGTTCATGCTGAAGACTGGCCCTTCAAATGTGAATT
N--F--V--C--N--V--C--E--S--P--F--L--S--I--K--D--L--T--K--H--L--S--V--H--A--E--D--W--P--F--K--C--E--F

----------------------------------------------------------------------------------------------------
--C--V--Q--L--F--K--D--K--T--D--L--S--E--H--R--F--L--L--H--G--V--G--N--I--F--V--C--S--V--C--K--K--E-
TTGTGTGCAGCTTTTTAAGGATAAAACGGACTTGTCAGAACATCGCTTTTTGCTTCATGGAGTTGGGAATATCTTTGTGTGTTCTGTTTGTAAAAAAGAA
::::::::::::.::::::: :::::: ::.:::::::::::::::::::::::::::::::: :::::::::::::::::::: :::::::::::::::
TTGTGTGCAGCTCTTTAAGGCTAAAACTGATTTGTCAGAACATCGCTTTTTGCTTCATGGAGTGGGGAATATCTTTGTGTGTTCGGTTTGTAAAAAAGAA
--C--V--Q--L--F--K--A--K--T--D--L--S--E--H--R--F--L--L--H--G--V--G--N--I--F--V--C--S--V--C--K--K--E-

----------------------------------------------------------------------------------------------------
-F--A--F--L--C--N--L--Q--Q--H--Q--R--D--L--H--P--D--K--V--C--T--H--H--E--F--E--S--G--T--L--R--P--Q--
TTTGCTTTTTTGTGCAATTTGCAGCAGCACCAGCGAGATCTCCACCCAGATAAGGTGTGCACACATCACGAGTTTGAAAGCGGGACTCTGAGGCCCCAGA
::::::::::::::::::::::::::::::::::: ::.::::::::::::.:::.:::::::::.::::::::::::::.:: ::.:::::::::::::
TTTGCTTTTTTGTGCAATTTGCAGCAGCACCAGCGCGACCTCCACCCAGATGAGGCGTGCACACACCACGAGTTTGAAAGTGGCACCCTGAGGCCCCAGA
-F--A--F--L--C--N--L--Q--Q--H--Q--R--D--L--H--P--D--E--A--C--T--H--H--E--F--E--S--G--T--L--R--P--Q--

----------------------------------------------------------------------------------------------------
N--F--T--D--P--S--K--A--H--V--E--H--M--Q--S--L--P--E--D--P--L--E--T--S--K--E--E--E--E--L--N--D--S--S
ACTTTACAGATCCCAGCAAGGCCCATGTAGAGCATATGCAGAGCTTGCCAGAAGATCCTTTAGAAACTTCTAAAGAAGAAGAGGAGTTAAATGATTCCTC
::::::::::.::::::::::: :.::..:::::.::::::.:.:::::.:::::::::::.::::: :::::.::::::::::::::.::.:::::.::
ACTTTACAGACCCCAGCAAGGCACGTGCGGAGCACATGCAGGGTTTGCCGGAAGATCCTTTGGAAACATCTAAGGAAGAAGAGGAGTTGAACGATTCTTC
N--F--T--D--P--S--K--A--R--A--E--H--M--Q--G--L--P--E--D--P--L--E--T--S--K--E--E--E--E--L--N--D--S--S

----------------------------------------------------------------------------------------------------
--E--E--L--Y--T--T--I--K--I--M--A--S--G--I--K--T--K--D--P--D--V--R--L--G--L--N--Q--H--Y--P--S--F--K-
TGAAGAGCTTTACACGACTATAAAAATAATGGCTTCTGGAATAAAGACAAAAGATCCAGATGTTCGATTGGGCCTCAATCAGCATTACCCAAGCTTTAAA
.::::::::::::::.::.:::::::::::::::::::::::::::::.::::::::.:::::.::::::::.:::::::::::::::::.:::::::::
CGAAGAGCTTTACACAACCATAAAAATAATGGCTTCTGGAATAAAGACGAAAGATCCGGATGTCCGATTGGGTCTCAATCAGCATTACCCGAGCTTTAAA
--E--E--L--Y--T--T--I--K--I--M--A--S--G--I--K--T--K--D--P--D--V--R--L--G--L--N--Q--H--Y--P--S--F--K-

----------------------------------------------------------------------------------------------------
-P--P--P--F--Q--Y--H--H--R--N--P--M--G--I--G--V--T--A--T--N--F--T--T--H--N--I--P--Q--T--F--T--T--A--
CCACCTCCATTTCAGTACCATCACCGTAACCCCATGGGGATTGGTGTGACAGCCACAAATTTCACTACACACAATATTCCACAGACTTTCACTACCGCCA
::.:::::::::::::::::::::::.:.:::: :::: :::::.:::::.:::::::::::::: ::::::::.::.::.::::: ::.::.:::::::
CCGCCTCCATTTCAGTACCATCACCGCAGCCCCCTGGGCATTGGCGTGACGGCCACAAATTTCACGACACACAACATCCCGCAGACGTTTACCACCGCCA
-P--P--P--F--Q--Y--H--H--R--S--P--L--G--I--G--V--T--A--T--N--F--T--T--H--N--I--P--Q--T--F--T--T--A--

----------------------------------------------------------------------------------------------------
I--R--C--T--K--C--G--K--G--V--D--N--M--P--E--L--H--K--H--I--L--A--C--A--S--A--S--D--K--K--R--Y--T--P
TTCGCTGCACAAAGTGTGGAAAAGGTGTCGACAATATGCCGGAGTTGCACAAACATATCCTGGCTTGTGCTTCTGCAAGTGACAAGAAGAGGTACACGCC
:.:::::::: ::::::::.::.::::: :::::.::::: :::.::::::::::.:::::::: ::::::::.:: ::.::::::::::::::::: ::
TCCGCTGCACCAAGTGTGGGAAGGGTGTGGACAACATGCCCGAGCTGCACAAACACATCCTGGCGTGTGCTTCCGCTAGCGACAAGAAGAGGTACACCCC
I--R--C--T--K--C--G--K--G--V--D--N--M--P--E--L--H--K--H--I--L--A--C--A--S--A--S--D--K--K--R--Y--T--P

----------------------------------------------------------------------------------------------------
--K--K--N--P--V--P--L--K--Q--T--V--Q--P--K--N--G--V--V--V--L--D--N--S--G--K--N--A--F--R--R--M--G--Q-
TAAGAAAAACCCAGTACCATTAAAACAAACTGTGCAACCCAAAAATGGCGTGGTGGTTTTAGATAACTCTGGGAAAAATGCCTTCCGACGAATGGGACAG
.:::::.::::: :: ::.::.::.::.::.:::::.::::::::.::::::::::::::.::.::: :.:::::.::::::::: :::: :::::.:::
CAAGAAGAACCCCGTCCCGTTGAAGCAGACCGTGCAGCCCAAAAACGGCGTGGTGGTTTTGGACAACGCCGGGAAGAATGCCTTCAGACGCATGGGGCAG
--K--K--N--P--V--P--L--K--Q--T--V--Q--P--K--N--G--V--V--V--L--D--N--A--G--K--N--A--F--R--R--M--G--Q-

----------------------------------------------------------------------------------------------------
-P--K--R--L--N--F--S--V--E--L--S--K--M--S--S--N--K--L--K--L--N--A--L--K--K--K--N--Q--L--V--Q--K--A--
CCCAAAAGGCTTAACTTTAGTGTTGAGCTCAGCAAAATGTCGTCGAATAAGCTCAAATTAAATGCATTGAAGAAAAAAAATCAGCTAGTACAGAAAGCAA
::::::::::: :::::.::.::.:::::::::::.::::: :::::::::::::::::::::::.::::::::::::::.::::: :: ::::::::::
CCCAAAAGGCTGAACTTCAGCGTCGAGCTCAGCAAGATGTCCTCGAATAAGCTCAAATTAAATGCGTTGAAGAAAAAAAACCAGCTTGTCCAGAAAGCAA
-P--K--R--L--N--F--S--V--E--L--S--K--M--S--S--N--K--L--K--L--N--A--L--K--K--K--N--Q--L--V--Q--K--A--

----------------------------------------------------------------------------------------------------
I--L--Q--K--N--K--S--A--K--Q--K--A--D--L--K--N--A--C--E--S--S--S--H--I--C--P--Y--C--N--R--E--F--T--Y
TTCTTCAGAAAAACAAATCTGCAAAGCAGAAGGCCGACTTGAAAAATGCTTGTGAGTCATCCTCTCACATCTGCCCTTACTGTAATCGAGAGTTCACTTA
:.:::::.:::::::::::::: :::::::::::::::.:.::: ::::.. .::: :  :::: ::::::::::: :::::.:..::::::::::: ::
TCCTTCAAAAAAACAAATCTGCCAAGCAGAAGGCCGACCTAAAACATGCCCCCGAGGCCGCCTCGCACATCTGCCCGTACTGCAGCCGAGAGTTCACGTA
I--L--Q--K--N--K--S--A--K--Q--K--A--D--L--K--H--A--P--E--A--A--S--H--I--C--P--Y--C--S--R--E--F--T--Y

----------------------------------------------------------------------------------------------------
--I--G--S--L--N--K--H--A--A--F--S--C--P--K--K--P--L--S--P--P--K--K--K--V--S--H--S--S--K--K--G--G--H-
CATTGGAAGCCTGAATAAACACGCCGCCTTCAGCTGTCCCAAAAAACCCCTTTCTCCTCCCAAAAAAAAAGTTTCTCATTCATCTAAGAAAGGTGGACAC
:::.:: ::::::::.::.::::::::::::::::::::::::::.::.:::::.:::.:::::                                    
CATCGGCAGCCTGAACAAGCACGCCGCCTTCAGCTGTCCCAAAAAGCCTCTTTCCCCTTCCAAA------------------------------------
--I--G--S--L--N--K--H--A--A--F--S--C--P--K--K--P--L--S--P--S--K-------------------------------------

----------------------------------------------------------------------------------------------------
-S--S--P--A--S--S--D--K--N--S--N--S--N--H--R--R--R--T--A--D--A--E--I--K--M--Q--S--M--Q--T--P--L--G--
TCATCACCTGCAAGTAGTGACAAAAACAGTAACAGCAACCACCGCAGACGGACAGCGGATGCGGAGATTAAAATGCAAAGCATGCAGACTCCGTTGGGCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
K--T--R--A--R--S--S--G--P--T--Q--V--P--L--P--S--S--S--F--R--S--K--Q--N--V--K--F--A--A--S--V--K--S--K
AGACCAGAGCCCGCAGCTCAGGCCCCACCCAAGTCCCACTTCCCTCCTCATCCTTCAGGTCCAAGCAGAACGTCAAGTTTGCAGCTTCGGTGAAATCCAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--K--P--S--S--S--S--L--R--N--S--S--P--I--R--M--A--K--I--T--H--V--E--G--K--K--P--K--A--V--A--K--N--H-
AAAACCAAGCTCCTCCTCTTTAAGGAACTCCAGCCCGATAAGAATGGCCAAAATAACTCATGTTGAGGGGAAAAAACCTAAAGCTGTGGCCAAGAATCAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-S--A--Q--L--S--S--K--T--S--R--S--L--H--V--R--V--Q--K--S--K--A--V--L--Q--S--K--S--T--L--A--S--K--K--
TCTGCTCAGCTTTCCAGCAAAACATCACGGAGCCTGCACGTGAGGGTACAGAAAAGCAAAGCTGTTTTACAAAGCAAATCCACCTTGGCGAGTAAGAAAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
R--T--D--R--F--N--I--K--S--R--E--R--S--G--G--P--V--T--R--S--L--Q--L--A--A--A--A--D--L--S--E--N--K--R
GAACAGACCGGTTCAATATAAAATCTAGAGAGCGGAGTGGGGGGCCAGTCACCCGGAGCCTTCAGCTGGCAGCTGCTGCTGACTTGAGTGAGAACAAGAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------><------------------------------------------------------------
--E--D--G--S--A--K--Q--E--L--K--D--F--S--Y--S--L--R--L--A--S--R--C--S--P--P--A--A--P--Y--I--T--R--Q-
AGAGGACGGCAGCGCCAAGCAGGAGCTGAAGGACTTCAGCTACAGCCTCCGCTTGGCGTCCCGATGCTCTCCACCAGCGGCCCCGTACATCACCAGGCAG
                                        :::::.::::::.::::::::::.::..::::.:::::::::.:::::::::::::::::
----------------------------------------TACAGTCTCCGCCTGGCGTCCCGGTGTCCTCCGCCAGCGGCCTCGTACATCACCAGGCAG
-----------------------------------------Y--S--L--R--L--A--S--R--C--P--P--P--A--A--S--Y--I--T--R--Q-

----------------------------------------------------------->
-Y--R--K--V--K--A--P--A--A--A--Q--F--Q--G--P--F--F--K--E--*-
TATAGGAAGGTCAAAGCTCCAGCTGCAGCCCAGTTCCAGGGACCATTCTTCAAAGAGTAG
:.:::::: :::::.::. :::: ::::::::::::::::::.: .::::::::::::::
TGTAGGAATGTCAAGGCCACAGCGGCAGCCCAGTTCCAGGGATCCCTCTTCAAAGAGTAG
-C--R--N--V--K--A--T--A--A--A--Q--F--Q--G--S--L--F--K--E--*-

Pig Consensus Sequence

>BGISUST0000900479
---------AACGCAGCTGAGCCTGTGGCAGCCGCCGAGACCCTGGCCGAGGTGCCTGAACATGTGCTTCGAGGACTTCCGGAGGAAGTGAGGCTTTTCC
CATCTGCTGTTGACAAGACTCGGATT---GTCTGGGCCACTAAACCAATTTTAAAAGGCAAAAAGTTTGGGCCATTTGTCGGTGATAAGAAAAAAAGGTC
TCAGGTTAAGAATAATGTATACATGTGGGAG---------------------------------------------------------------------
------------------------------------------------------------------------------------CCAATCGCGCCGGGCG
AGGAGCTCCTGGTCTGGTAcaATGGGGAAGACAACCCCGAGATAGCAGCTGCGATTGAGGAAGAGCGAGCCAGCGCCCGGAGCAAGCGGAGCTCCCCGAA
AAGCAGGAAA------------------------------------------------GATACACAACTGAAGACAAGTGAGCCAGATTCCAGCTCTGCA
AATATGAGAGATTCTGCGGAA-------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
--------------------------------------------------------------TCCCCTGCTTCCTACTCTCCCTCTTCCTTCTCTTCGTC
GTCGTCCTCCTCCTCCCCCTCACCACCTCCCCTCTCCGCAGTCTCCTCCGTGGTGTCCTCAGGGGATAACCTGGAAGCCTCTCTCCCCATGATCTCTTTC
AAGCAGGAGGAGTTAGAGAACGAGGATCTGAAAGCCAGGGAAGAAGCCCAGGCTGCCGCGGAGCGGGCTGTCGTTCAGGAGACATTCAACAAAAACTTTG
TCTGCAACGTCTGTGAATCGCCTTTTCTTTCCATTAAAGATCTAACCAAACATTTATCCGTTCATGCTGAAGACTGGCCCTTCAAATGTGAATTTTGTGT
GCAGCTCTTTAAGGCTAAAACTGATTTGTCAGAACATCGCTTTTTGCTTCATGGAGTGGGGAATATCTTTGTGTGTTCGGTTTGTAAAAAAGAATTTGCT
TTTTTGTGCAATTTGCAGCAGCACCAGCGCGACCTCCACCCAGATGAGGCGTGCACACACCACGAGTTTGAAAGTGGCACCCTGAGGCCCCAGAACTTTA
CAGACCCCAGCAAGGCACGTGCGGAGCACATGCAGGGTTTGCCGGAAGATCCTTTGGAAACATCTAAGGAAGAAGAGGAGTTGAACGATTCTTCCGAAGA
GCTTTACACAACCATAAAAATAATGGCTTCTGGAATAAAGACGAAAGATCCGGATGTCCGATTGGGTCTCAATCAGCATTACCCGAGCTTTAAACCGCCT
CCATTTCAGTACCATCACCGCAGCCCCCTGGGCATTGGCGTGACGGCCACAAATTTCACGACACACAACATCCCGCAGACGTTTACCACCGCCATCCGCT
GCACCAAGTGTGGGAAGGGTGTGGACAACATGCCCGAGCTGCACAAACACATCCTGGCGTGTGCTTCCGCTAGCGACAAGAAGAGGTACACCCCCAAGAA
GAACCCCGTCCCGTTGAAGCAGACCGTGCAGCCCAAAAACGGCGTGGTGGTTTTGGACAACGCCGGGAAGAATGCCTTCAGACGCATGGGGCAGCCCAAA
AGGCTGAACTTCAGCGTCGAGCTCAGCAAGATGTCCTCGAATAAGCTCAAATTAAATGCGTTGAAGAAAAAAAACCAGCTTGTCCAGAAAGCAATCCTTC
AAAAAAACAAATCTGCCAAGCAGAAGGCCGACCTAAAACATGCCCCCGAGGCCGCCTCGCACATCTGCCCGTACTGCAGCCGAGAGTTCACGTACATCGG
CAGCCTGAACAAGCACGCCGCCTTCAGCTGTCCCAAAAAGCCTCTTTCCCCTTCCAAA------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------TACAGTCTCCGCCTGGCGTCCCGGTGTCCTCCGCCAGCGGCCTCGTACATCACCAGGCAGTGTAGG
AATGTCAAGGCCACAGCGGCAGCCCAGTTCCAGGGATCCCTCTTCAAAGAGTAG


>BGISUSP0000900479
---NAAEPVAAAETLAEVPEHVLRGLPEEVRLFPSAVDKTRI-VWATKPILKGKKFGPFVGDKKKRSQVKNNVYMWE-----------------------
----------------------------PIAPGEELLVWYNGEDNPEIAAAIEEERASARSKRSSPKSRK----------------DTQLKTSEPDSSSA
NMRDSAE---------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
------------------------------------------------------SPASYSPSSFSSSSSSSSPSPPPLSAVSSVVSSGDNLEASLPMISF
KQEELENEDLKAREEAQAAAERAVVQETFNKNFVCNVCESPFLSIKDLTKHLSVHAEDWPFKCEFCVQLFKAKTDLSEHRFLLHGVGNIFVCSVCKKEFA
FLCNLQQHQRDLHPDEACTHHEFESGTLRPQNFTDPSKARAEHMQGLPEDPLETSKEEEELNDSSEELYTTIKIMASGIKTKDPDVRLGLNQHYPSFKPP
PFQYHHRSPLGIGVTATNFTTHNIPQTFTTAIRCTKCGKGVDNMPELHKHILACASASDKKRYTPKKNPVPLKQTVQPKNGVVVLDNAGKNAFRRMGQPK
RLNFSVELSKMSSNKLKLNALKKKNQLVQKAILQKNKSAKQKADLKHAPEAASHICPYCSREFTYIGSLNKHAAFSCPKKPLSPSK--------------
----------------------------------------------------------------------------------------------------
------------------------------------------------------------------------------YSLRLASRCPPPAASYITRQCR
NVKATAAAQFQGSLFKE*