Sequences
EST Library Info
che1Heart - RNA from China
csp2Spleen - RNA from China
pigca2Unavailable
spl1Spleen
Clusters
Oligos
SNPs

Gene ID ENSG00000117228 (click for geneview)
Transcript ID ENST00000235880(link to ensembl)
Symbol GBP1
Localtion Chromosome:1:89230026:89242912:-1 band: 1p22.2
Description Interferon-induced guanylate-binding protein 1 (GTP-binding protein 1) (Guanine nucleotide-binding protein 1) (HuGBP-1). [Source:Uniprot/SWISSPROT;Acc:P32455]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--S--E--I--H--M--T--G--P--M--C--L--I--E--N--T--N--G--R--L--M--A--N--P--E--A--L--K--I--L--S--A--
ATGGCATCAGAGATCCACATGACAGGCCCAATGTGCCTCATTGAGAACACTAATGGGCGACTGATGGCGAATCCAGAAGCTCTGAAGATCCTTTCTGCCA
::::: :::.::.: :::::: : :. :::  :::::::::::::::::..::::::::::::..::.:::.::..:::: :::::: :::: :::::::
ATGGCCTCAAAGGTGCACATGCCCGAACCACAGTGCCTCATTGAGAACATCAATGGGCGACTGGCGGTGAACCCGAAAGCGCTGAAGCTCCTGTCTGCCA
-M--A--S--K--V--H--M--P--E--P--Q--C--L--I--E--N--I--N--G--R--L--A--V--N--P--K--A--L--K--L--L--S--A--

-----------------------------------------------------------------------------------------><---------
I--T--Q--P--M--V--V--V--A--I--V--G--L--Y--R--T--G--K--S--Y--L--M--N--K--L--A--G--K--K--K--G--F--S--L
TTACACAGCCTATGGTGGTGGTGGCAATTGTGGGCCTCTACCGCACAGGCAAATCCTACCTGATGAACAAGCTGGCTGGAAAGAAAAAGGGCTTCTCTCT
:.: .:::::. ::::::::::::: ::.:::::::: :::::::::::::::::::::::::::::::::::::::::.::::: :::   ::::::::
TCAAGCAGCCCCTGGTGGTGGTGGCTATCGTGGGCCTGTACCGCACAGGCAAATCCTACCTGATGAACAAGCTGGCTGGGAAGAACAAG---TTCTCTCT
I--K--Q--P--L--V--V--V--A--I--V--G--L--Y--R--T--G--K--S--Y--L--M--N--K--L--A--G--K--N--K-----F--S--L

----------------------------------------------------------------------------------------------------
--G--S--T--V--Q--S--H--T--K--G--I--W--M--W--C--V--P--H--P--K--K--P--G--H--I--L--V--L--L--D--T--E--G-
GGGCTCCACGGTGCAGTCTCACACTAAAGGAATCTGGATGTGGTGTGTGCCCCACCCCAAGAAGCCAGGCCACATCCTAGTTCTGCTGGACACCGAGGGT
:::::::::::::::::::::::: ::.:: ::::::::::::::::::::.::::::::::::: ::. ::::.:::.:::::::: :::::::::::.
GGGCTCCACGGTGCAGTCTCACACAAAGGGCATCTGGATGTGGTGTGTGCCTCACCCCAAGAAGCGAGAACACACCCTGGTTCTGCTCGACACCGAGGGC
--G--S--T--V--Q--S--H--T--K--G--I--W--M--W--C--V--P--H--P--K--K--R--E--H--T--L--V--L--L--D--T--E--G-

-----------------><---------------------------------------------------------------------------------
-L--G--D--V--E--K--G--D--N--Q--N--D--S--W--I--F--A--L--A--V--L--L--S--S--T--F--V--Y--N--S--I--G--T--
CTGGGAGATGTAGAGAAGGGTGACAACCAGAATGACTCCTGGATCTTCGCCCTGGCCGTCCTCCTGAGCAGCACCTTCGTGTACAATAGCATAGGAACCA
:::::.::::: ::::::::::::::::::::.::::::::::::::::::::::: .:.:::::::::::::::::::: :::::.:::::.::.::::
CTGGGGGATGTTGAGAAGGGTGACAACCAGAACGACTCCTGGATCTTCGCCCTGGCAATTCTCCTGAGCAGCACCTTCGTCTACAACAGCATGGGGACCA
-L--G--D--V--E--K--G--D--N--Q--N--D--S--W--I--F--A--L--A--I--L--L--S--S--T--F--V--Y--N--S--M--G--T--

---------------------------><-----------------------------------------------------------------------
I--N--Q--Q--A--M--D--Q--L--Y--Y--V--T--E--L--T--H--R--I--R--S--K--S--S--P--D--E--N--E--N--E--V--E--D
TCAACCAGCAGGCTATGGACCAACTGTACTATGTGACAGAGCTGACACATAGAATCCGATCAAAATCCTCACCTGATGAGAATGAGAATGAGGTTGAGGA
:.:::::::::::.::::::::.                                                                     .:::::::
TTAACCAGCAGGCCATGGACCAG---------------------------------------------------------------------ATTGAGGA
I--N--Q--Q--A--M--D--Q-----------------------------------------------------------------------I--E--D

----------------------------------------------------------------------------------------------------
--S--A--D--F--V--S--F--F--P--D--F--V--W--T--L--R--D--F--S--L--D--L--E--A--D--G--Q--P--L--T--P--D--E-
TTCAGCTGACTTTGTGAGCTTCTTCCCAGACTTTGTGTGGACACTGAGAGATTTCTCCCTGGACTTGGAAGCAGATGGACAACCCCTCACACCAGATGAG
.::.::::::::::::::::::::.:::::::::::::::::.::: :.::.::::::::::::::::::.:::::::: ::.:: ::::: ::::.:::
CTCGGCTGACTTTGTGAGCTTCTTTCCAGACTTTGTGTGGACGCTGCGGGACTTCTCCCTGGACTTGGAAACAGATGGAGAATCCATCACAGCAGACGAG
--S--A--D--F--V--S--F--F--P--D--F--V--W--T--L--R--D--F--S--L--D--L--E--T--D--G--E--S--I--T--A--D--E-

------------------------------><--------------------------------------------------------------------
-Y--L--T--Y--S--L--K--L--K--K--G--T--S--Q--K--D--E--T--F--N--L--P--R--L--C--I--R--K--F--F--P--K--K--
TACCTGACATACTCCCTGAAGCTGAAGAAAGGTACCAGTCAAAAAGATGAAACTTTTAACCTGCCCAGACTCTGTATCCGGAAATTCTTCCCAAAGAAAA
::::::. . :::: :: ::::: :::      :::::::::::::::.::: ::::::::::::. ::::::::::::::::.:::::::: :::::.:
TACCTGGAGAACTCACTCAAGCTTAAG------ACCAGTCAAAAAGATAAAAATTTTAACCTGCCTCGACTCTGTATCCGGAAGTTCTTCCCCAAGAAGA
-Y--L--E--N--S--L--K--L--K--------T--S--Q--K--D--K--N--F--N--L--P--R--L--C--I--R--K--F--F--P--K--K--

----------------------------------------------------------------------------------------------------
K--C--F--V--F--D--R--P--V--H--R--R--K--L--A--Q--L--E--K--L--Q--D--E--E--L--D--P--E--F--V--Q--Q--V--A
AATGCTTTGTCTTTGATCGGCCCGTTCACCGCAGGAAGCTTGCCCAGCTCGAGAAACTACAAGATGAAGAGCTGGACCCCGAATTTGTGCAACAAGTAGC
::::::::.::::::::::::::..:::  : :.:::::: : ::::::.:::.: ::. . ::.:: :::::::::.: ::::::::::::::::. ::
AATGCTTTATCTTTGATCGGCCCACTCAGAGGAAGAAGCTGGGCCAGCTTGAGGATCTGGGTGACGATGAGCTGGACTCAGAATTTGTGCAACAAGCTGC
K--C--F--I--F--D--R--P--T--Q--R--K--K--L--G--Q--L--E--D--L--G--D--D--E--L--D--S--E--F--V--Q--Q--A--A

-------------------------------------------------------------------------><-------------------------
--D--F--C--S--Y--I--F--S--N--S--K--T--K--T--L--S--G--G--I--Q--V--N--G--P--R--L--E--S--L--V--L--T--Y-
AGACTTCTGTTCCTACATCTTTAGTAATTCCAAAACTAAAACTCTTTCAGGAGGCATCCAGGTCAACGGGCCTCGTCTAGAGAGCCTGGTGCTGACCTAC
::: :::::::::::::::::.   ::::::::::: ::::::::::::::::::::: :::::: .:::      ::.:::: :::::::::::::: .
AGAGTTCTGTTCCTACATCTTCTTAAATTCCAAAACGAAAACTCTTTCAGGAGGCATCAAGGTCACTGGG------CTGGAGACCCTGGTGCTGACCTTT
--E--F--C--S--Y--I--F--L--N--S--K--T--K--T--L--S--G--G--I--K--V--T--G--------L--E--T--L--V--L--T--F-

----------------------------------------------------------------------------------------------------
-V--N--A--I--S--S--G--D--L--P--C--M--E--N--A--V--L--A--L--A--Q--I--E--N--S--A--A--V--Q--K--A--I--A--
GTCAATGCCATCAGCAGTGGGGATCTGCCGTGCATGGAGAACGCAGTCCTGGCCTTGGCCCAGATAGAGAACTCAGCTGCAGTGCAAAAGGCTATTGCCC
:::::..::::::::::::::::.::::: :::::::::::.::::::::::::.::::. :::: ::::::::.::.::::::::.:::::.:::::::
GTCAACACCATCAGCAGTGGGGACCTGCCCTGCATGGAGAATGCAGTCCTGGCCCTGGCTGAGATCGAGAACTCGGCCGCAGTGCAGAAGGCCATTGCCC
-V--N--T--I--S--S--G--D--L--P--C--M--E--N--A--V--L--A--L--A--E--I--E--N--S--A--A--V--Q--K--A--I--A--

----------------------------------------------------------------------------------------------------
H--Y--E--Q--Q--M--G--Q--K--V--Q--L--P--T--E--T--L--Q--E--L--L--D--L--H--R--D--S--E--R--E--A--I--E--V
ACTATGAACAGCAGATGGGCCAGAAGGTGCAGCTGCCCACAGAAACCCTCCAGGAGCTGCTGGACCTGCACAGGGACAGTGAGAGAGAGGCCATTGAAGT
:::::::.:::::::::: : ::::: :::::::::::::.::.::::: :::::::::::::::::::::::::::. .::::..::::::::::: .:
ACTATGAGCAGCAGATGGCCGAGAAGCTGCAGCTGCCCACGGAGACCCTGCAGGAGCTGCTGGACCTGCACAGGGACGTCGAGAAGGAGGCCATTGACAT
H--Y--E--Q--Q--M--A--E--K--L--Q--L--P--T--E--T--L--Q--E--L--L--D--L--H--R--D--V--E--K--E--A--I--D--I

------------------------------------------------------><--------------------------------------------
--F--I--R--S--S--F--K--D--V--D--H--L--F--Q--K--E--L--A--A--Q--L--E--K--K--R--D--D--F--C--K--Q--N--Q-
CTTCATCAGGAGTTCCTTCAAAGATGTGGACCATCTATTTCAAAAGGAGTTAGCGGCCCAGCTAGAAAAAAAGCGGGATGACTTTTGTAAACAGAATCAG
:::::: :.::.:::::::::::::: .::  :. ::::.::::::::.::::::                                             
CTTCATGAAGAATTCCTTCAAAGATGAAGAGAACGTATTCCAAAAGGAATTAGCG---------------------------------------------
--F--M--K--N--S--F--K--D--E--E--N--V--F--Q--K--E--L--A----------------------------------------------

----------------------------------------------------------------------------------------------------
-E--A--S--S--D--R--C--S--A--L--L--Q--V--I--F--S--P--L--E--E--E--V--K--A--G--I--Y--S--K--P--G--G--Y--
GAAGCATCATCAGATCGTTGCTCAGCTTTACTTCAGGTCATTTTCAGTCCTCTAGAAGAAGAAGTGAAGGCGGGAATTTATTCGAAACCAGGGGGCTATC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------------------------------><-------------------------------
R--L--F--V--Q--K--L--Q--D--L--K--K--K--Y--Y--E--E--P--R--K--G--I--Q--A--E--E--I--L--Q--T--Y--L--K--S
GTCTCTTTGTTCAGAAGCTACAAGACCTGAAGAAAAAGTACTATGAGGAACCGAGGAAGGGGATACAGGCTGAAGAGATTCTGCAGACATACTTGAAATC
                                                                    :: ::::::::.:: :::. :::::::::.::
--------------------------------------------------------------------GCGGAAGAGATCCTCCAGGAATACTTGAAGTC
---------------------------------------------------------------------A--E--E--I--L--Q--E--Y--L--K--S

----------------------------------------------------------------------><----------------------------
--K--E--S--M--T--D--A--I--L--Q--T--D--Q--T--L--T--E--K--E--K--E--I--E--V--E--R--V--K--A--E--S--A--Q-
CAAGGAGTCTATGACTGATGCAATTCTCCAGACAGACCAGACTCTCACAGAAAAAGAAAAGGAGATTGAAGTGGAACGTGTGAAAGCTGAGTCTGCACAG
::::::::::.::. .:: :::::::: :::::::::::::::::: :.::.::::::::: ::::.:::   ::::::::::.::::::. ::::::::
CAAGGAGTCTGTGGGCGAAGCAATTCTACAGACAGACCAGACTCTCTCGGAGAAAGAAAAGCAGATCGAA---GAACGTGTGAGAGCTGAAGCTGCACAG
--K--E--S--V--G--E--A--I--L--Q--T--D--Q--T--L--S--E--K--E--K--Q--I--E-----E--R--V--R--A--E--A--A--Q-

----------------------------------------------------------------------------------------------------
-A--S--A--K--M--L--Q--E--M--Q--R--K--N--E--Q--M--M--E--Q--K--E--R--S--Y--Q--E--H--L--K--Q--L--T--E--
GCTTCAGCAAAAATGTTGCAGGAAATGCAAAGAAAGAATGAGCAGATGATGGAACAGAAGGAGAGGAGTTATCAGGAACACTTGAAACAACTGACTGAGA
::: :::: ::::::.:: ::::.::::::: ::.:::. ::::::: :::::::::::.::.:.:::::::::::::::: :::.:::.:::.::::::
GCTGCAGCCAAAATGCTGGAGGAGATGCAAATAAGGAACCAGCAGATTATGGAACAGAAAGAAAAGAGTTATCAGGAACACGTGAGACAGCTGGCTGAGA
-A--A--A--K--M--L--E--E--M--Q--I--R--N--Q--Q--I--M--E--Q--K--E--K--S--Y--Q--E--H--V--R--Q--L--A--E--

----------------------------------------------------------------><----------------------------------
K--M--E--N--D--R--V--Q--L--L--K--E--Q--E--R--T--L--A--L--K--L--Q--E--Q--E--Q--L--L--K--E--G--F--Q--K
AGATGGAGAACGACAGGGTCCAGTTGCTGAAAGAGCAAGAGAGGACCCTCGCTCTTAAACTTCAGGAACAGGAGCAACTACTAAAAGAGGGATTTCAAAA
:::::::::: ::: :::.:::: :::::.::::::::::::::::  : ::::::::.::::::                                   
AGATGGAGAAGGACCGGGCCCAGATGCTGGAAGAGCAAGAGAGGACGATGGCTCTTAAGCTTCAG-----------------------------------
K--M--E--K--D--R--A--Q--M--L--E--E--Q--E--R--T--M--A--L--K--L--Q------------------------------------

------------------------------------------------------------------------------>
--E--S--R--I--M--K--N--E--I--Q--D--L--Q--T--K--M--R--R--R--K--A--C--T--I--S--*-
AGAAAGCAGAATAATGAAAAATGAGATACAGGATCTCCAGACGAAAATGAGACGACGAAAGGCATGTACCATAAGCTAA
                                                                               
-------------------------------------------------------------------------------
-------------------------------------------------------------------------------

Pig Consensus Sequence

>BGISUST0000898263
ATGGCCTCAAAGGTGCACATGCCCGAACCACAGTGCCTCATTGAGAACATCAATGGGCGACTGGCGGTGAACCCGAAAGCGCTGAAGCTCCTGTCTGCCA
TCAAGCAGCCCCTGGTGGTGGTGGCTATCGTGGGCCTGTACCGCACAGGCAAATCCTACCTGATGAACAAGCTGGCTGGGAAGAACAAG---TTCTCTCT
GGGCTCCACGGTGCAGTCTCACACAAAGGGCATCTGGATGTGGTGTGTGCCTCACCCCAAGAAGCGAGAACACACCCTGGTTCTGCTCGACACCGAGGGC
CTGGGGGATGTTGAGAAGGGTGACAACCAGAACGACTCCTGGATCTTCGCCCTGGCAATTCTCCTGAGCAGCACCTTCGTCTACAACAGCATGGGGACCA
TTAACCAGCAGGCCATGGACCAG---------------------------------------------------------------------ATTGAGGA
CTCGGCTGACTTTGTGAGCTTCTTTCCAGACTTTGTGTGGACGCTGCGGGACTTCTCCCTGGACTTGGAAACAGATGGAGAATCCATCACAGCAGACGAG
TACCTGGAGAACTCACTCAAGCTTAAG------ACCAGTCAAAAAGATAAAAATTTTAACCTGCCTCGACTCTGTATCCGGAAGTTCTTCCCCAAGAAGA
AATGCTTTATCTTTGATCGGCCCACTCAGAGGAAGAAGCTGGGCCAGCTTGAGGATCTGGGTGACGATGAGCTGGACTCAGAATTTGTGCAACAAGCTGC
AGAGTTCTGTTCCTACATCTTCTTAAATTCCAAAACGAAAACTCTTTCAGGAGGCATCAAGGTCACTGGG------CTGGAGACCCTGGTGCTGACCTTT
GTCAACACCATCAGCAGTGGGGACCTGCCCTGCATGGAGAATGCAGTCCTGGCCCTGGCTGAGATCGAGAACTCGGCCGCAGTGCAGAAGGCCATTGCCC
ACTATGAGCAGCAGATGGCCGAGAAGCTGCAGCTGCCCACGGAGACCCTGCAGGAGCTGCTGGACCTGCACAGGGACGTCGAGAAGGAGGCCATTGACAT
CTTCATGAAGAATTCCTTCAAAGATGAAGAGAACGTATTCCAAAAGGAATTAGCG---------------------------------------------
----------------------------------------------------------------------------------------------------
--------------------------------------------------------------------GCGGAAGAGATCCTCCAGGAATACTTGAAGTC
CAAGGAGTCTGTGGGCGAAGCAATTCTACAGACAGACCAGACTCTCTCGGAGAAAGAAAAGCAGATCGAA---GAACGTGTGAGAGCTGAAGCTGCACAG
GCTGCAGCCAAAATGCTGGAGGAGATGCAAATAAGGAACCAGCAGATTATGGAACAGAAAGAAAAGAGTTATCAGGAACACGTGAGACAGCTGGCTGAGA
AGATGGAGAAGGACCGGGCCCAGATGCTGGAAGAGCAAGAGAGGACGATGGCTCTTAAGCTTCAG-----------------------------------
-------------------------------------------------------------------------------


>BGISUSP0000898263
MASKVHMPEPQCLIENINGRLAVNPKALKLLSAIKQPLVVVAIVGLYRTGKSYLMNKLAGKNK-FSLGSTVQSHTKGIWMWCVPHPKKREHTLVLLDTEG
LGDVEKGDNQNDSWIFALAILLSSTFVYNSMGTINQQAMDQ-----------------------IEDSADFVSFFPDFVWTLRDFSLDLETDGESITADE
YLENSLKLK--TSQKDKNFNLPRLCIRKFFPKKKCFIFDRPTQRKKLGQLEDLGDDELDSEFVQQAAEFCSYIFLNSKTKTLSGGIKVTG--LETLVLTF
VNTISSGDLPCMENAVLALAEIENSAAVQKAIAHYEQQMAEKLQLPTETLQELLDLHRDVEKEAIDIFMKNSFKDEENVFQKELA---------------
--------------------------------------------------------AEEILQEYLKSKESVGEAILQTDQTLSEKEKQIE-ERVRAEAAQ
AAAKMLEEMQIRNQQIMEQKEKSYQEHVRQLAEKMEKDRAQMLEEQERTMALKLQ--------------------------------------