Sequences
EST Library Info
aor5Aorta
cbl2Blood
csp2Spleen - RNA from China
cst1Stomach - RNA from China
cut1Uterus - RNA from China
ebs2Foetus 50 days, brain stem
ecc3Foetus 50 days, cortex cerebri
eep1Foetus 50 days, epidermis
eje1Foetus 50 days, jejunum
fat2Fatt
jca2Joint capsule
mcp2Mammae, collostrum producing
med1Mediastinum
nmm1Newborn 115 days, mucosal membranes
ssp1M. Supraspinatus
tes3Testes
thg1Thyroid gland
ton1Tip of tongue, mucosal membrane
Clusters
Oligos
SNPs

Gene ID ENSG00000118181 (click for geneview)
Transcript ID ENST00000236900(link to ensembl)
Symbol RPS25
Localtion Chromosome:11:118391635:118394267:-1 band: 11q23.3
Description 40S ribosomal protein S25.
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-><----------------------------------------------------------------------------------------------><
-M--P--P--K--D--D--K--K--K--K--D--A--G--K--S--A--K--K--D--K--D--P--V--N--K--S--G--G--K--A--K--K--K--
ATGCCGCCTAAGGACGACAAGAAGAAGAAGGACGCTGGAAAGTCGGCCAAGAAAGACAAAGACCCAGTGAACAAATCCGGGGGCAAGGCCAAAAAGAAGA
   :::::.::::.::::::::::.::::.::.::.:::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::
---CCGCCCAAGGGCGACAAGAAGGAGAAAGATGCCGGAAAGTCGGCCAAGAAAGACAAAGACCCAGTGAACAAATCTGGGGGCAAGGCCAAAAAGAAGA
----P--P--K--G--D--K--K--E--K--D--A--G--K--S--A--K--K--D--K--D--P--V--N--K--S--G--G--K--A--K--K--K--

----------------------------------------------------------------------------------------------------
K--W--S--K--G--K--V--R--D--K--L--N--N--L--V--L--F--D--K--A--T--Y--D--K--L--C--K--E--V--P--N--Y--K--L
AGTGGTCCAAAGGCAAAGTTCGGGACAAGCTCAATAACTTAGTCTTGTTTGACAAAGCTACCTATGATAAACTCTGTAAGGAAGTTCCCAACTATAAACT
::::::::::::::::::::::::::::::::::::::.::::::::::::::::::: :: :::::.:::::::::::.:::::::::::::::::.::
AGTGGTCCAAAGGCAAAGTTCGGGACAAGCTCAATAACCTAGTCTTGTTTGACAAAGCGACATATGACAAACTCTGTAAAGAAGTTCCCAACTATAAGCT
K--W--S--K--G--K--V--R--D--K--L--N--N--L--V--L--F--D--K--A--T--Y--D--K--L--C--K--E--V--P--N--Y--K--L

----------------------------------------------------------------------------------><----------------
--I--T--P--A--V--V--S--E--R--L--K--I--R--G--S--L--A--R--A--A--L--Q--E--L--L--S--K--G--L--I--K--L--V-
TATAACCCCAGCTGTGGTCTCTGAGAGACTGAAGATTCGAGGCTCCCTGGCCAGGGCAGCCCTTCAGGAGCTCCTTAGTAAAGGACTTATCAAACTGGTT
::::::.:::::::: ::::::::::::::::::::::: ::.::.:::::::::::::::::::::::.::::: ::.:::   :::::.:::::::::
TATAACTCCAGCTGTTGTCTCTGAGAGACTGAAGATTCGTGGTTCTCTGGCCAGGGCAGCCCTTCAGGAACTCCTGAGCAAA---CTTATTAAACTGGTT
--I--T--P--A--V--V--S--E--R--L--K--I--R--G--S--L--A--R--A--A--L--Q--E--L--L--S--K-----L--I--K--L--V-

----------------------------------------------------------------------------->
-S--K--H--R--A--Q--V--I--Y--T--R--N--T--K--G--G--D--A--P--A--A--G--E--D--A--*-
TCAAAGCACAGAGCTCAAGTAATTTACACCAGAAATACCAAGGGTGGAGATGCTCCAGCTGCTGGTGAAGATGCATGA
:::::::::::::::::::::::::::::: ::::::::::::::::::::::.::::::::::: ::::::::::.:
TCAAAGCACAGAGCTCAAGTAATTTACACCCGAAATACCAAGGGTGGAGATGCCCCAGCTGCTGGAGAAGATGCATAA
-S--K--H--R--A--Q--V--I--Y--T--R--N--T--K--G--G--D--A--P--A--A--G--E--D--A--*-

Pig Consensus Sequence

>BGISUST0000890200
---CCGCCCAAGGGCGACAAGAAGGAGAAAGATGCCGGAAAGTCGGCCAAGAAAGACAAAGACCCAGTGAACAAATCTGGGGGCAAGGCCAAAAAGAAGA
AGTGGTCCAAAGGCAAAGTTCGGGACAAGCTCAATAACCTAGTCTTGTTTGACAAAGCGACATATGACAAACTCTGTAAAGAAGTTCCCAACTATAAGCT
TATAACTCCAGCTGTTGTCTCTGAGAGACTGAAGATTCGTGGTTCTCTGGCCAGGGCAGCCCTTCAGGAACTCCTGAGCAAA---CTTATTAAACTGGTT
TCAAAGCACAGAGCTCAAGTAATTTACACCCGAAATACCAAGGGTGGAGATGCCCCAGCTGCTGGAGAAGATGCATAA


>BGISUSP0000890200
-PPKGDKKEKDAGKSAKKDKDPVNKSGGKAKKKKWSKGKVRDKLNNLVLFDKATYDKLCKEVPNYKLITPAVVSERLKIRGSLARAALQELLSK-LIKLV
SKHRAQVIYTRNTKGGDAPAAGEDA*