Sequences
EST Library Info
gul1Gullet
tes3Testes
Clusters
Oligos
SNPs

Gene ID ENSG00000189007 (click for geneview)
Transcript ID ENST00000237283(link to ensembl)
Symbol DEADC1
Localtion Chromosome:6:143789821:143813483:-1 band: 6q24.2
Description deaminase domain containing 1 [Source:RefSeq_peptide;Acc:NP_872309]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-><------------------------------------------------------------------------------------------------
-M--A--K--E--A--L--E--N--T--E--V--P--V--G--C--L--M--V--Y--N--N--E--V--V--G--K--G--R--N--E--V--N--Q--
ATGGCCAAAGAAGCCCTCGAAAATACTGAAGTTCCTGTTGGCTGTCTTATGGTCTACAACAATGAAGTTGTAGGGAAGGGGAGAAATGAAGTTAACCAAA
                              ::::::::::::::.::.:::::::::::::::::::::::.::::::::.:::::.::::::::.::::
------------------------------GTTCCTGTTGGCTGCCTCATGGTCTACAACAATGAAGTTGTGGGGAAGGGAAGAAACGAAGTTAATCAAA
-------------------------------V--P--V--G--C--L--M--V--Y--N--N--E--V--V--G--K--G--R--N--E--V--N--Q--

-------><-------------------------------------------------------------------------------------------
T--K--N--A--T--R--H--A--E--M--V--A--I--D--Q--V--L--D--W--C--R--Q--S--G--K--S--P--S--E--V--F--E--H--T
CCAAAAATGCTACTCGACATGCAGAAATGGTGGCCATCGATCAGGTCCTCGATTGGTGTCGTCAAAGTGGCAAGAGTCCCTCTGAAGTATTTGAACACAC
:::::::::::::::::::::::::.::::::::::::::.:::::::: ::.:::::::.::.:.:::::::::::::.:: :::::.:::::::.:::
CCAAAAATGCTACTCGACATGCAGAGATGGTGGCCATCGACCAGGTCCTAGACTGGTGTCATCGAGGTGGCAAGAGTCCTTCGGAAGTGTTTGAACGCAC
T--K--N--A--T--R--H--A--E--M--V--A--I--D--Q--V--L--D--W--C--H--R--G--G--K--S--P--S--E--V--F--E--R--T

----------------------------------------------------------><><----------------><--------------------
--V--L--Y--V--T--V--E--P--C--I--M--C--A--A--A--L--R--L--M--R--L--I--L--S--Y--K--P--L--V--V--Y--G--C-
TGTGTTGTATGTCACTGTGGAGCCGTGCATTATGTGTGCAGCTGCTCTCCGCCTGATGAGATTAATTCTGTCTTATAAACCGCTGGTTGTATATGGCTGT
:::::::::::::::.:::::::::::.::.:::::.:::::::::::::::::::::                     ::::::::.:: :::::::::
TGTGTTGTATGTCACCGTGGAGCCGTGTATCATGTGCGCAGCTGCTCTCCGCCTGATG---------------------CCGCTGGTCGTCTATGGCTGT
--V--L--Y--V--T--V--E--P--C--I--M--C--A--A--A--L--R--L--M-----------------------P--L--V--V--Y--G--C-

--------------------------------------------------------------------------------><------------------
-Q--N--E--R--F--G--G--C--G--S--V--L--N--I--A--S--A--D--L--P--N--T--G--R--P--F--Q--C--I--P--G--Y--R--
CAGAATGAACGATTTGGTGGTTGTGGCTCTGTTCTAAATATTGCCTCTGCTGACCTACCAAACACTGGGAGACCATTTCAGTGTATCCCTGGATATCGGG
:::::.:::::::::::.::.:::::::::::::::.:.::::: ::::::::..::::.::.:::::::::::.::::::::.::::::::::::::::
CAGAACGAACGATTTGGCGGCTGTGGCTCTGTTCTAGACATTGCGTCTGCTGATTTACCGAATACTGGGAGACCGTTTCAGTGCATCCCTGGATATCGGG
-Q--N--E--R--F--G--G--C--G--S--V--L--D--I--A--S--A--D--L--P--N--T--G--R--P--F--Q--C--I--P--G--Y--R--

-----------------------------------------------------><------------------------------------------>
A--E--E--A--V--E--M--L--K--T--F--Y--K--Q--E--N--P--N--A--P--K--S--K--V--R--K--K--E--C--Q--K--S--*-
CTGAGGAAGCAGTGGAAATGTTAAAGACCTTCTACAAACAAGAAAATCCAAATGCACCAAAATCGAAAGTTCGGAAAAAGGAATGTCAGAAATCTTGA
:::::::::::::::::::::::::::::::.:::::::::::::::::::::   ::::::::.::.:::::::::::::::::.::::::::.:::
CTGAGGAAGCAGTGGAAATGTTAAAGACCTTTTACAAACAAGAAAATCCAAAT---CCAAAATCAAAGGTTCGGAAAAAGGAATGCCAGAAATCCTGA
A--E--E--A--V--E--M--L--K--T--F--Y--K--Q--E--N--P--N-----P--K--S--K--V--R--K--K--E--C--Q--K--S--*-

Pig Consensus Sequence

>BGISUST0000901679
------------------------------GTTCCTGTTGGCTGCCTCATGGTCTACAACAATGAAGTTGTGGGGAAGGGAAGAAACGAAGTTAATCAAA
CCAAAAATGCTACTCGACATGCAGAGATGGTGGCCATCGACCAGGTCCTAGACTGGTGTCATCGAGGTGGCAAGAGTCCTTCGGAAGTGTTTGAACGCAC
TGTGTTGTATGTCACCGTGGAGCCGTGTATCATGTGCGCAGCTGCTCTCCGCCTGATG---------------------CCGCTGGTCGTCTATGGCTGT
CAGAACGAACGATTTGGCGGCTGTGGCTCTGTTCTAGACATTGCGTCTGCTGATTTACCGAATACTGGGAGACCGTTTCAGTGCATCCCTGGATATCGGG
CTGAGGAAGCAGTGGAAATGTTAAAGACCTTTTACAAACAAGAAAATCCAAAT---CCAAAATCAAAGGTTCGGAAAAAGGAATGCCAGAAATCCTGA


>BGISUSP0000901679
----------VPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLDWCHRGGKSPSEVFERTVLYVTVEPCIMCAAALRLM-------PLVVYGC
QNERFGGCGSVLDIASADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQENPN-PKSKVRKKECQKS*