Sequences
EST Library Info
cki2Kidney - RNA from China
pigcb2Unavailable
pliv1Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000109689 (click for geneview)
Transcript ID ENST00000237364(link to ensembl)
Symbol STIM2
Localtion Chromosome:4:26538580:26703272:1 band: 4p15.2
Description Stromal interaction molecule 2 precursor. [Source:Uniprot/SWISSPROT;Acc:Q9P246]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--N--A--A--G--I--R--A--P--E--A--A--G--A--D--G--T--R--L--A--P--G--G--S--P--C--L--R--R--R--G--R--P--
ATGAACGCAGCCGGGATCAGAGCTCCGGAGGCCGCCGGTGCCGATGGGACCAGGCTGGCGCCCGGCGGGAGCCCGTGTCTGAGGCGGCGGGGGCGGCCGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
E--E--S--P--A--A--V--V--A--P--R--G--A--G--E--L--Q--A--A--G--A--P--L--R--F--H--P--A--S--P--R--R--L--H
AGGAGTCGCCGGCGGCGGTGGTGGCGCCTCGCGGAGCCGGCGAGCTGCAGGCGGCCGGGGCGCCGCTGCGCTTTCACCCGGCTTCTCCTCGGCGCCTTCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--P--A--S--T--P--G--P--A--W--G--W--L--L--R--R--R--R--W--A--A--L--L--V--L--G--L--L--V--A--G--A--A--D-
TCCCGCCTCGACTCCTGGCCCAGCGTGGGGCTGGCTGCTGCGGCGGCGGCGCTGGGCTGCGTTGCTGGTGCTCGGGCTGCTGGTAGCCGGAGCGGCGGAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-G--C--E--L--V--P--R--H--L--R--G--R--R--A--T--G--S--A--A--T--A--A--S--S--P--A--A--A--A--G--D--S--P--
GGATGCGAGCTTGTGCCCCGGCACCTCCGCGGGCGGCGGGCGACTGGCTCTGCCGCAACTGCCGCCTCCTCTCCCGCCGCGGCGGCCGGCGATAGCCCGG
                                             :::::::::: ..: :::::::::::::::::::::::::: :::::.:::::::
---------------------------------------------GGCTCTGCCGGGGCGGCCGCCTCCTCTCCCGCCGCGGCGGCGGGCGACAGCCCGG
----------------------------------------------G--S--A--G--A--A--A--S--S--P--A--A--A--A--G--D--S--P--

-----------><---------------------------------------------------------------------------------------
A--L--M--T--D--P--C--M--S--L--S--P--P--C--F--T--E--E--D--R--F--S--L--E--A--L--Q--T--I--H--K--Q--M--D
CGCTCATGACAGATCCCTGCATGTCACTGAGTCCACCATGCTTTACAGAAGAAGACAGATTTAGTCTGGAAGCTCTTCAAACAATACATAAACAAATGGA
::::::::      :::::: ::::::::::::::::::::::.:::::::::::.:::::.::::::::::::::::::::::::::::::::::::::
CGCTCATG------CCCTGCTTGTCACTGAGTCCACCATGCTTCACAGAAGAAGATAGATTCAGTCTGGAAGCTCTTCAAACAATACATAAACAAATGGA
A--L--M--------P--C--L--S--L--S--P--P--C--F--T--E--E--D--R--F--S--L--E--A--L--Q--T--I--H--K--Q--M--D

------------------------------------------><--------------------------------------------------------
--D--D--K--D--G--G--I--E--V--E--E--S--D--E--F--I--R--E--D--M--K--Y--K--D--A--T--N--K--H--S--H--L--H-
TGATGACAAAGATGGTGGAATTGAAGTAGAGGAAAGTGATGAATTCATCAGAGAAGATATGAAATATAAAGATGCTACTAATAAACACAGCCATCTGCAC
::::::::::::.::::::::::::::::: :::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::.:::
TGATGACAAAGACGGTGGAATTGAAGTAGATGAAAGTGATGAATTCATCAGAGAAGATATGAAATACAAAGATGCTACTAATAAACACAGCCATCTACAC
--D--D--K--D--G--G--I--E--V--D--E--S--D--E--F--I--R--E--D--M--K--Y--K--D--A--T--N--K--H--S--H--L--H-

---------------------------------------------------------><-----------------------------------------
-R--E--D--K--H--I--T--I--E--D--L--W--K--R--W--K--T--S--E--V--H--N--W--T--L--E--D--T--L--Q--W--L--I--
AGAGAAGATAAACATATAACGATTGAGGATTTATGGAAACGATGGAAAACATCAGAAGTTCATAATTGGACCCTTGAAGACACTCTTCAGTGGTTGATAG
:::::::::::.::.::::: .::::::::::::::::::..:::::.:::::::::   :::::::::::::::::.::::: ::::::::::::::::
AGAGAAGATAAGCACATAACTGTTGAGGATTTATGGAAACAGTGGAAGACATCAGAA---CATAATTGGACCCTTGAGGACACACTTCAGTGGTTGATAG
-R--E--D--K--H--I--T--V--E--D--L--W--K--Q--W--K--T--S--E-----H--N--W--T--L--E--D--T--L--Q--W--L--I--

---------------------------------------------------------------------><-----------------------------
E--F--V--E--L--P--Q--Y--E--K--N--F--R--D--N--N--V--K--G--T--T--L--P--R--I--A--V--H--E--P--S--F--M--I
AGTTTGTTGAACTACCCCAATATGAGAAGAATTTTAGAGACAACAATGTCAAAGGAACGACACTTCCCAGGATAGCAGTGCACGAACCTTCATTTATGAT
:.:::::::::::::::::::::::::::::::::::::::::.::::::::::::::.::.::::::   :::::::: ::.::: :::::::::::::
AATTTGTTGAACTACCCCAATATGAGAAGAATTTTAGAGACAATAATGTCAAAGGAACAACGCTTCCC---ATAGCAGTTCATGAAACTTCATTTATGAT
E--F--V--E--L--P--Q--Y--E--K--N--F--R--D--N--N--V--K--G--T--T--L--P-----I--A--V--H--E--T--S--F--M--I

-------------------------------------------------------------------------------------><-------------
--S--Q--L--K--I--S--D--R--S--H--R--Q--K--L--Q--L--K--A--L--D--V--V--L--F--G--P--L--T--R--P--P--H--N-
CTCCCAGTTGAAAATCAGTGACCGGAGTCACAGACAAAAACTTCAGCTCAAGGCATTGGATGTGGTTTTGTTTGGACCTCTAACACGCCCACCTCATAAC
.:::::::::::::::::::::::::::::::::::.::::::::.:::::.:::.:::::::::::::::::::.:::::.:::   :: ::::::::.
TTCCCAGTTGAAAATCAGTGACCGGAGTCACAGACAGAAACTTCAACTCAAAGCACTGGATGTGGTTTTGTTTGGGCCTCTGACA---CCTCCTCATAAT
--S--Q--L--K--I--S--D--R--S--H--R--Q--K--L--Q--L--K--A--L--D--V--V--L--F--G--P--L--T-----P--P--H--N-

----------------------------------------------------------------------------------------------------
-W--M--K--D--F--I--L--T--V--S--I--V--I--G--V--G--G--C--W--F--A--Y--T--Q--N--K--T--S--K--E--H--V--A--
TGGATGAAAGATTTTATCCTCACAGTTTCTATAGTAATTGGTGTTGGAGGCTGCTGGTTTGCTTATACGCAGAATAAGACATCAAAAGAACATGTTGCAA
::::::::::::::::::::::: :::::::::::::::::::::::::: ::::::::::::::.::.:::::::::::::::::::::::::::::::
TGGATGAAAGATTTTATCCTCACTGTTTCTATAGTAATTGGTGTTGGAGGGTGCTGGTTTGCTTACACACAGAATAAGACATCAAAAGAACATGTTGCAA
-W--M--K--D--F--I--L--T--V--S--I--V--I--G--V--G--G--C--W--F--A--Y--T--Q--N--K--T--S--K--E--H--V--A--

---------------------------------------------------------------><-----------------------------------
K--M--M--K--D--L--E--S--L--Q--T--A--E--Q--S--L--M--D--L--Q--E--R--L--E--K--A--Q--E--E--N--R--N--V--A
AAATGATGAAAGATTTAGAGAGCTTACAAACTGCAGAGCAAAGTCTAATGGACTTACAGGAGAGGCTTGAAAAGGCACAGGAAGAAAACAGAAATGTTGC
:::::::::::::.::::::::..::::.::::::::::::::::: :::::::::::.:::   :::::::::::::::::::::::::::::::::::
AAATGATGAAAGACTTAGAGAGTCTACAGACTGCAGAGCAAAGTCTCATGGACTTACAAGAG---CTTGAAAAGGCACAGGAAGAAAACAGAAATGTTGC
K--M--M--K--D--L--E--S--L--Q--T--A--E--Q--S--L--M--D--L--Q--E-----L--E--K--A--Q--E--E--N--R--N--V--A

----------------------------------------------------------------------------------------------------
--V--E--K--Q--N--L--E--R--K--M--M--D--E--I--N--Y--A--K--E--E--A--C--R--L--R--E--L--R--E--G--A--E--C-
TGTAGAAAAGCAAAATTTAGAGCGCAAAATGATGGATGAAATCAATTATGCAAAGGAGGAGGCTTGTCGGCTGAGAGAGCTAAGGGAGGGAGCTGAATGT
:::::::::::::::..:::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::
TGTAGAAAAGCAAAACCTAGAGCGCAAAATGATGGATGAAATCAATTACGCAAAGGAGGAGGCTTGTCGGCTGAGAGAGCTAAGGGAGGGAGCTGAATGT
--V--E--K--Q--N--L--E--R--K--M--M--D--E--I--N--Y--A--K--E--E--A--C--R--L--R--E--L--R--E--G--A--E--C-

-----------------------------------------><---------------------------------------------------------
-E--L--S--R--R--Q--Y--A--E--Q--E--L--E--Q--V--R--M--A--L--K--K--A--E--K--E--F--E--L--R--S--S--W--S--
GAATTGAGTAGACGTCAGTATGCAGAACAGGAATTGGAACAGGTTCGCATGGCTCTGAAAAAGGCCGAAAAAGAATTTGAACTGAGAAGCAGTTGGTCTG
:::::::::::::::::.::::::::.:::::::::::::::::::: ::::::.:.::::::::.::::::::::::::::: ::::::::.:::::::
GAATTGAGTAGACGTCAATATGCAGAGCAGGAATTGGAACAGGTTCGAATGGCTTTAAAAAAGGCTGAAAAAGAATTTGAACTCAGAAGCAGCTGGTCTG
-E--L--S--R--R--Q--Y--A--E--Q--E--L--E--Q--V--R--M--A--L--K--K--A--E--K--E--F--E--L--R--S--S--W--S--

----------------------------------------------------------------------------------------------------
V--P--D--A--L--Q--K--W--L--Q--L--T--H--E--V--E--V--Q--Y--Y--N--I--K--R--Q--N--A--E--M--Q--L--A--I--A
TTCCAGATGCACTTCAGAAATGGCTTCAGTTAACACATGAAGTAGAAGTGCAATACTACAATATTAAAAGACAAAACGCTGAAATGCAGCTAGCTATTGC
::::::::::::::::.::::::::::::.::::.:::::::::::::: ::.:::::::::::::::::.::.::.:::::::::::.:::::::::::
TTCCAGATGCACTTCAAAAATGGCTTCAGCTAACGCATGAAGTAGAAGTCCAGTACTACAATATTAAAAGGCAGAATGCTGAAATGCAACTAGCTATTGC
V--P--D--A--L--Q--K--W--L--Q--L--T--H--E--V--E--V--Q--Y--Y--N--I--K--R--Q--N--A--E--M--Q--L--A--I--A

---------><-----------------------------------------------------------------------------------------
--K--D--E--A--E--K--I--K--K--K--R--S--T--V--F--G--T--L--H--V--A--H--S--S--S--L--D--E--V--D--H--K--I-
TAAAGATGAGGCAGAAAAAATTAAAAAGAAGAGAAGCACAGTCTTTGGGACTCTGCACGTTGCACACAGCTCCTCCCTAGATGAGGTAGACCACAAAATT
:::::::::::::::.:::::::::::::::::::::::::::::::::::.:::::.::::::::.:::::::::::::::::.:::::.::.::::::
TAAAGATGAGGCAGAGAAAATTAAAAAGAAGAGAAGCACAGTCTTTGGGACCCTGCATGTTGCACATAGCTCCTCCCTAGATGAAGTAGATCATAAAATT
--K--D--E--A--E--K--I--K--K--K--R--S--T--V--F--G--T--L--H--V--A--H--S--S--S--L--D--E--V--D--H--K--I-

----------><----------------------------------------------------------------------------------------
-L--E--A--K--K--A--L--S--E--L--T--T--C--L--R--E--R--L--F--R--W--Q--Q--I--E--K--I--C--G--F--Q--I--A--
CTGGAAGCAAAGAAAGCTCTCTCTGAGTTGACAACTTGTTTACGAGAACGACTTTTTCGCTGGCAACAAATTGAGAAGATCTGTGGCTTTCAGATAGCCC
:::::::::   :::::::::::::::::::::::::::::::::::::::::::::::::::::.::.:::::::::::::::::::::::::::::::
CTGGAAGCA---AAAGCTCTCTCTGAGTTGACAACTTGTTTACGAGAACGACTTTTTCGCTGGCAGCAGATTGAGAAGATCTGTGGCTTTCAGATAGCCC
-L--E--A-----K--A--L--S--E--L--T--T--C--L--R--E--R--L--F--R--W--Q--Q--I--E--K--I--C--G--F--Q--I--A--

----------------------------------------------------------------------------------------------------
H--N--S--G--L--P--S--L--T--S--S--L--Y--S--D--H--S--W--V--V--M--P--R--V--S--I--P--P--Y--P--I--A--G--G
ATAACTCAGGACTCCCCAGCCTGACCTCTTCCCTTTATTCTGATCACAGCTGGGTGGTGATGCCCAGAGTCTCCATTCCACCCTATCCAATTGCTGGAGG
:::::::.:::::::::::::: :::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::.:: :::::::::::
ATAACTCGGGACTCCCCAGCCTCACCTCTTCCCTCTATTCTGATCACAGCTGGGTGGTGATGCCCAGAGTCTCCATTCCACCCTACCCCATTGCTGGAGG
H--N--S--G--L--P--S--L--T--S--S--L--Y--S--D--H--S--W--V--V--M--P--R--V--S--I--P--P--Y--P--I--A--G--G

-------------------------------------------------><-------------------------------------------------
--V--D--D--L--D--E--D--T--P--P--I--V--S--Q--F--P--G--T--M--A--K--P--P--G--S--L--A--R--S--S--S--L--C-
AGTTGATGACTTAGATGAAGACACACCCCCAATAGTGTCACAATTTCCCGGGACCATGGCTAAACCTCCTGGATCATTAGCCAGAAGCAGCAGCCTGTGC
:::::::::.::::::::::::::::::::::::::::::::.:::      :::::::::::.::: ::: ::::.:.:::::::::::::::.::::.
AGTTGATGATTTAGATGAAGACACACCCCCAATAGTGTCACAGTTT------ACCATGGCTAAGCCTGCTGCATCACTGGCCAGAAGCAGCAGCTTGTGT
--V--D--D--L--D--E--D--T--P--P--I--V--S--Q--F--------T--M--A--K--P--A--A--S--L--A--R--S--S--S--L--C-

----------------------------------------------------------------------------------------------------
-R--S--R--R--S--I--V--P--S--S--P--Q--P--Q--R--A--Q--L--A--P--H--A--P--H--P--S--H--P--R-----H--P--H--
CGTTCACGCCGCAGCATTGTGCCGTCCTCGCCTCAGCCTCAGCGAGCTCAGCTTGCTCCACACGCCCCCCACCCGTCACACCCTCGG---CACCCTCACC
::.:: :::::::::::.:::::::::::::: :::.::::::: ::::::::: ::::::::::.::::::::::::::::::::    :::::.::::
CGCTCCCGCCGCAGCATCGTGCCGTCCTCGCCGCAGTCTCAGCGCGCTCAGCTTCCTCCACACGCTCCCCACCCGTCACACCCTCGTG--CACCCCCACC
-R--S--R--R--S--I--V--P--S--S--P--Q--S--Q--R--A--Q--L--P--P--H--A--P--H--P--S--H--P--R--\--H--P--H--

----------------------------------------------------------------------------------------------------
H--P-----Q--H--T--P--H--S--L--P--S--P--D--P--D--I--L--S--V--S--S--C--P--A--L--Y--R--N--E--E--E--E--E
ACCCG---CAACACACACCACACTCCTTGCCTTCCCCTGATCCAGATATCCTCTCAGTGTCAAGTTGCCCTGCGCTTTATCGAAATGAAGAGGAGGAAGA
::::    ::.::::::: .::::: :::::::::::.::::::::::::::::::::::::::::::::.:: :::::::::::::::::::::::.::
ACCCCC--CAGCACACACAGCACTCGTTGCCTTCCCCCGATCCAGATATCCTCTCAGTGTCAAGTTGCCCCGCTCTTTATCGAAATGAAGAGGAGGAGGA
H--P--\--Q--H--T--Q--H--S--L--P--S--P--D--P--D--I--L--S--V--S--S--C--P--A--L--Y--R--N--E--E--E--E--E

-----------------------------><---------------------------------------------------------------------
--A--I--Y--F--S--A--E--K--Q--W--E--V--P--D--T--A--S--E--C--D--S--L--N--S--S--I--G--R--K--Q--S--P--P-
GGCCATTTACTTCTCTGCTGAAAAGCAATGGGAAGTGCCAGACACAGCTTCAGAATGTGACTCCTTAAATTCTTCCATTGGAAGGAAACAGTCTCCTCCT
::::::::::::::::::::::::::::   :::::::::::::::::.:::::::::::::::::.:::::::::::.:::::::::::::::::::::
GGCCATTTACTTCTCTGCTGAAAAGCAA---GAAGTGCCAGACACAGCCTCAGAATGTGACTCCTTGAATTCTTCCATCGGAAGGAAACAGTCTCCTCCT
--A--I--Y--F--S--A--E--K--Q-----E--V--P--D--T--A--S--E--C--D--S--L--N--S--S--I--G--R--K--Q--S--P--P-

----------------------------------------------------------------------------------------------------
-L--S--L--E--I--Y--Q--T--L--S--P--R--K--I--S--R--D--E--V--S--L--E--D--S--S--R--G--D--S--P--V--T--V--
TTAAGCCTCGAGATATACCAAACATTATCTCCGCGAAAGATATCAAGAGATGAGGTGTCCCTAGAGGATTCCTCCCGAGGGGATTCGCCTGTAACTGTGG
:. :::::.::::: ::::: ::.::.:: :: :::::.:: ::.:.::::::: : ::.::.:::::::::::: ::::.::.:::::.:: .: :. :
TCCAGCCTTGAGATCTACCACACGTTGTCGCCTCGAAAAATCTCGAAAGATGAGCTCTCTCTGGAGGATTCCTCCAGAGGAGACTCGCCCGTCGCGGCCG
-S--S--L--E--I--Y--H--T--L--S--P--R--K--I--S--K--D--E--L--S--L--E--D--S--S--R--G--D--S--P--V--A--A--

----------------------------------------------------------------------------------------------------
D--V--S--W--G--S--P--D--C--V--G--L--T--E--T--K--S--M--I--F--S--P--A--S--K--V--Y--N--G--I--L--E--K--S
ATGTGTCTTGGGGTTCTCCCGACTGTGTAGGTCTGACAGAAACTAAGAGTATGATCTTCAGTCCTGCAAGCAAAGTGTACAATGGCATTTTGGAGAAATC
:.:::::..::::.::.:::::.::.:: :: :::::.:::::.:::::.:::::::::::.:::::.::::::::::::::.:::::.::::::::.::
ACGTGTCCCGGGGCTCCCCCGATTGCGTCGGGCTGACGGAAACCAAGAGCATGATCTTCAGCCCTGCGAGCAAAGTGTACAACGGCATCTTGGAGAAGTC
D--V--S--R--G--S--P--D--C--V--G--L--T--E--T--K--S--M--I--F--S--P--A--S--K--V--Y--N--G--I--L--E--K--S

----------------------------------------------------------------------------------------------------
--C--S--M--N--Q--L--S--S--G--I--P--V--P--K--P--R--H--T--S--C--S--S--A--G--N--D--S--K--P--V--Q--E--A-
CTGTAGCATGAACCAGCTTTCCAGTGGCATCCCGGTGCCTAAACCTCGCCACACATCATGTTCCTCAGCTGGCAACGACAGTAAACCAGTTCAGGAAGCC
:::.::::::::::::::::::::::::::::::::::: ::::::::::::::.::.::.:: :::::.:::::::::::.::::: :  :::::.:::
CTGCAGCATGAACCAGCTTTCCAGTGGCATCCCGGTGCCGAAACCTCGCCACACGTCGTGCTCGTCAGCCGGCAACGACAGCAAACCCGGGCAGGAGGCC
--C--S--M--N--Q--L--S--S--G--I--P--V--P--K--P--R--H--T--S--C--S--S--A--G--N--D--S--K--P--G--Q--E--A-

----------------------------------------------------------------------------------------------------
-P--S--V--A--R--I--S--S--I--P--H--D--L--C--H--N--G--E--K--S--K--K--P--S--K--I--K--S--L--F--K--K--K--
CCAAGTGTTGCCAGAATAAGCAGCATCCCACATGACCTTTGTCATAATGGAGAGAAAAGCAAAAAGCCATCAAAAATCAAAAGCCTTTTTAAGAAGAAAT
::.::.::.:::::.:::::::::::::: :::::::::::::::::.::::::::::::::::::::::: :::::.::::::::::::::::::::::
CCGAGCGTCGCCAGGATAAGCAGCATCCCTCATGACCTTTGTCATAACGGAGAGAAAAGCAAAAAGCCATCCAAAATTAAAAGCCTTTTTAAGAAGAAAT
-P--S--V--A--R--I--S--S--I--P--H--D--L--C--H--N--G--E--K--S--K--K--P--S--K--I--K--S--L--F--K--K--K--

------->
S--K--*-
CTAAGTGA
:.::::::
CCAAGTGA
S--K--*-

Pig Consensus Sequence

>BGISUST0000899725
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------------------------------------GGCTCTGCCGGGGCGGCCGCCTCCTCTCCCGCCGCGGCGGCGGGCGACAGCCCGG
CGCTCATG------CCCTGCTTGTCACTGAGTCCACCATGCTTCACAGAAGAAGATAGATTCAGTCTGGAAGCTCTTCAAACAATACATAAACAAATGGA
TGATGACAAAGACGGTGGAATTGAAGTAGATGAAAGTGATGAATTCATCAGAGAAGATATGAAATACAAAGATGCTACTAATAAACACAGCCATCTACAC
AGAGAAGATAAGCACATAACTGTTGAGGATTTATGGAAACAGTGGAAGACATCAGAA---CATAATTGGACCCTTGAGGACACACTTCAGTGGTTGATAG
AATTTGTTGAACTACCCCAATATGAGAAGAATTTTAGAGACAATAATGTCAAAGGAACAACGCTTCCC---ATAGCAGTTCATGAAACTTCATTTATGAT
TTCCCAGTTGAAAATCAGTGACCGGAGTCACAGACAGAAACTTCAACTCAAAGCACTGGATGTGGTTTTGTTTGGGCCTCTGACA---CCTCCTCATAAT
TGGATGAAAGATTTTATCCTCACTGTTTCTATAGTAATTGGTGTTGGAGGGTGCTGGTTTGCTTACACACAGAATAAGACATCAAAAGAACATGTTGCAA
AAATGATGAAAGACTTAGAGAGTCTACAGACTGCAGAGCAAAGTCTCATGGACTTACAAGAG---CTTGAAAAGGCACAGGAAGAAAACAGAAATGTTGC
TGTAGAAAAGCAAAACCTAGAGCGCAAAATGATGGATGAAATCAATTACGCAAAGGAGGAGGCTTGTCGGCTGAGAGAGCTAAGGGAGGGAGCTGAATGT
GAATTGAGTAGACGTCAATATGCAGAGCAGGAATTGGAACAGGTTCGAATGGCTTTAAAAAAGGCTGAAAAAGAATTTGAACTCAGAAGCAGCTGGTCTG
TTCCAGATGCACTTCAAAAATGGCTTCAGCTAACGCATGAAGTAGAAGTCCAGTACTACAATATTAAAAGGCAGAATGCTGAAATGCAACTAGCTATTGC
TAAAGATGAGGCAGAGAAAATTAAAAAGAAGAGAAGCACAGTCTTTGGGACCCTGCATGTTGCACATAGCTCCTCCCTAGATGAAGTAGATCATAAAATT
CTGGAAGCA---AAAGCTCTCTCTGAGTTGACAACTTGTTTACGAGAACGACTTTTTCGCTGGCAGCAGATTGAGAAGATCTGTGGCTTTCAGATAGCCC
ATAACTCGGGACTCCCCAGCCTCACCTCTTCCCTCTATTCTGATCACAGCTGGGTGGTGATGCCCAGAGTCTCCATTCCACCCTACCCCATTGCTGGAGG
AGTTGATGATTTAGATGAAGACACACCCCCAATAGTGTCACAGTTT------ACCATGGCTAAGCCTGCTGCATCACTGGCCAGAAGCAGCAGCTTGTGT
CGCTCCCGCCGCAGCATCGTGCCGTCCTCGCCGCAGTCTCAGCGCGCTCAGCTTCCTCCACACGCTCCCCACCCGTCACACCCTCGtcACCCCCACCACC
CccAGCACACACAGCACTCGTTGCCTTCCCCCGATCCAGATATCCTCTCAGTGTCAAGTTGCCCCGCTCTTTATCGAAATGAAGAGGAGGAGGAGGCCAT
TTACTTCTCTGCTGAAAAGCAA---GAAGTGCCAGACACAGCCTCAGAATGTGACTCCTTGAATTCTTCCATCGGAAGGAAACAGTCTCCTCCTTCCAGC
CTTGAGATCTACCACACGTTGTCGCCTCGAAAAATCTCGAAAGATGAGCTCTCTCTGGAGGATTCCTCCAGAGGAGACTCGCCCGTCGCGGCCGACGTGT
CCCGGGGCTCCCCCGATTGCGTCGGGCTGACGGAAACCAAGAGCATGATCTTCAGCCCTGCGAGCAAAGTGTACAACGGCATCTTGGAGAAGTCCTGCAG
CATGAACCAGCTTTCCAGTGGCATCCCGGTGCCGAAACCTCGCCACACGTCGTGCTCGTCAGCCGGCAACGACAGCAAACCCGGGCAGGAGGCCCCGAGC
GTCGCCAGGATAAGCAGCATCCCTCATGACCTTTGTCATAACGGAGAGAAAAGCAAAAAGCCATCCAAAATTAAAAGCCTTTTTAAGAAGAAATCCAAGT
GA


>BGISUSP0000899725
----------------------------------------------------------------------------------------------------
---------------GSAGAAASSPAAAAGDSPALM--PCLSLSPPCFTEEDRFSLEALQTIHKQMDDDKDGGIEVDESDEFIREDMKYKDATNKHSHLH
REDKHITVEDLWKQWKTSE-HNWTLEDTLQWLIEFVELPQYEKNFRDNNVKGTTLP-IAVHETSFMISQLKISDRSHRQKLQLKALDVVLFGPLT-PPHN
WMKDFILTVSIVIGVGGCWFAYTQNKTSKEHVAKMMKDLESLQTAEQSLMDLQE-LEKAQEENRNVAVEKQNLERKMMDEINYAKEEACRLRELREGAEC
ELSRRQYAEQELEQVRMALKKAEKEFELRSSWSVPDALQKWLQLTHEVEVQYYNIKRQNAEMQLAIAKDEAEKIKKKRSTVFGTLHVAHSSSLDEVDHKI
LEA-KALSELTTCLRERLFRWQQIEKICGFQIAHNSGLPSLTSSLYSDHSWVVMPRVSIPPYPIAGGVDDLDEDTPPIVSQF--TMAKPAASLARSSSLC
RSRRSIVPSSPQSQRAQLPPHAPHPSHPRHPHHPQHTQHSLPSPDPDILSVSSCPALYRNEEEEEAIYFSAEKQ-EVPDTASECDSLNSSIGRKQSPPSS
LEIYHTLSPRKISKDELSLEDSSRGDSPVAADVSRGSPDCVGLTETKSMIFSPASKVYNGILEKSCSMNQLSSGIPVPKPRHTSCSSAGNDSKPGQEAPS
VARISSIPHDLCHNGEKSKKPSKIKSLFKKKSK*