Sequences
EST Library Info
cmu2Rhinal mucous membrane - RNA from China
cte3Testicle - RNA from China
gul1Gullet
lnt1Lymphatic nodule tracheobroncalis
nep1Newborn 115 days, epidermis
nmm1Newborn 115 days, mucosal membranes
ova4Ovary
pgl4Pituitary gland
plac3Unavailable
plun1Unavailable
ret2Retina
sin1Small intestine
ski2Skin
spc2Spinal cord
thg1Thyroid gland
Clusters
Oligos
SNPs

Gene ID ENSG00000119616 (click for geneview)
Transcript ID ENST00000238591(link to ensembl)
Symbol CN111_HUMAN
Localtion Chromosome:14:74249602:74273170:1 band: 14q24.3
Description  
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-><------------------------------------------------------------------><----------------------------
-M--G--K--Q--K--K--T--R--K--Y--A--T--M--K--R--M--L--S--L--R--D--Q--R--L--K--E--K--D--R--L--K--P--K--
ATGGGGAAGCAAAAGAAAACAAGGAAGTATGCGACCATGAAGCGAATGCTTAGTCTCAGAGATCAGAGGCTTAAAGAAAAGGATAGATTAAAACCTAAAA
   :::::::::::::::::: :::::::::: :.:::::::::::::::::::::::::::::::      ::::::::::::::::::::::: ::::
---GGGAAGCAAAAGAAAACACGGAAGTATGCTATCATGAAGCGAATGCTTAGTCTCAGAGATCAG------AAAGAAAAGGATAGATTAAAACCGAAAA
----G--K--Q--K--K--T--R--K--Y--A--I--M--K--R--M--L--S--L--R--D--Q--------K--E--K--D--R--L--K--P--K--

------------------------------------------><--------------------------------------------------------
K--K--E--K--K--D--P--S--A--L--K--E--R--E--V--P--Q--H--P--S--C--L--F--F--Q--Y--N--T--Q--L--G--P--P--Y
AGAAAGAAAAGAAGGATCCCAGCGCATTAAAGGAAAGAGAAGTTCCCCAACACCCTTCCTGCTTATTTTTCCAATATAATACACAGCTGGGCCCACCTTA
:::::::::::::.::::::::.:::.: ::::::::::::   ::::::::::::::::::.::::.::::::::::::::::::::::::::::::::
AGAAAGAAAAGAAAGATCCCAGTGCACTCAAGGAAAGAGAA---CCCCAACACCCTTCCTGCCTATTCTTCCAATATAATACACAGCTGGGCCCACCTTA
K--K--E--K--K--D--P--S--A--L--K--E--R--E-----P--Q--H--P--S--C--L--F--F--Q--Y--N--T--Q--L--G--P--P--Y

-------------------------------------------------------------------------------------------><-------
--H--I--L--V--D--T--N--F--I--N--F--S--I--K--A--K--L--D--L--V--Q--S--M--M--D--C--L--Y--A--K--C--I--P-
CCACATCCTCGTTGATACCAACTTTATCAACTTTTCCATAAAAGCCAAACTGGACTTAGTGCAGTCAATGATGGACTGTCTGTATGCCAAGTGTATCCCA
::::::::: ::::::::::::::::::::::::::::: :::::::::::::::::::::::::::::::::::::::::.:::::::::   ::::::
CCACATCCTGGTTGATACCAACTTTATCAACTTTTCCATTAAAGCCAAACTGGACTTAGTGCAGTCAATGATGGACTGTCTATATGCCAAG---ATCCCA
--H--I--L--V--D--T--N--F--I--N--F--S--I--K--A--K--L--D--L--V--Q--S--M--M--D--C--L--Y--A--K-----I--P-

----------------------------------------------------------------><----------------------------------
-C--I--T--D--C--V--M--A--E--I--E--K--L--G--Q--K--Y--R--V--A--L--R--I--A--K--D--P--R--F--E--R--L--P--
TGTATAACCGATTGTGTAATGGCTGAAATTGAGAAATTGGGGCAGAAGTATCGAGTGGCTCTAAGGATTGCCAAGGATCCAAGATTTGAACGATTACCAT
::::::::.::.:::::::::::::::::::::::::::::::::::::::::::::::::::   :::: ::::::::::::::::::::::::::: :
TGTATAACTGACTGTGTAATGGCTGAAATTGAGAAATTGGGGCAGAAGTATCGAGTGGCTCTA---ATTGACAAGGATCCAAGATTTGAACGATTACCCT
-C--I--T--D--C--V--M--A--E--I--E--K--L--G--Q--K--Y--R--V--A--L-----I--D--K--D--P--R--F--E--R--L--P--

----------------------------------------------------><----------------------------------------------
C--T--H--K--G--T--Y--A--D--D--C--L--V--Q--R--V--T--Q--H--K--C--Y--I--V--A--T--V--D--R--D--L--K--R--R
GTACACACAAAGGAACCTATGCAGATGACTGCTTAGTACAGAGAGTAACTCAGCATAAGTGTTACATTGTGGCCACAGTTGACCGGGACCTGAAAAGAAG
:.:::::::::::::::::::::::::::::::::::::::::::::::.:::::.::::::::::::::::::::::::::::::::::: ::: ::::
GCACACACAAAGGAACCTATGCAGATGACTGCTTAGTACAGAGAGTAACCCAGCACAAGTGTTACATTGTGGCCACAGTTGACCGGGACCTTAAACGAAG
C--T--H--K--G--T--Y--A--D--D--C--L--V--Q--R--V--T--Q--H--K--C--Y--I--V--A--T--V--D--R--D--L--K--R--R

-----------------------------------------------><----------------------------------------------->
--I--R--K--I--P--G--V--P--I--M--Y--I--S--N--H--R--Y--N--I--E--R--M--P--D--D--Y--G--A--P--R--F--*-
AATCCGTAAGATTCCTGGAGTTCCTATCATGTACATTTCTAACCATAGATACAACATTGAACGGATGCCAGATGATTATGGAGCCCCTCGATTCTAA
:::::: :::::.:::::::::::.:::::::::::::::::::::   :::::::::::.:::::::: ::::::::::::::::::::.::::::
AATCCGGAAGATCCCTGGAGTTCCCATCATGTACATTTCTAACCAT---TACAACATTGAGCGGATGCCCGATGATTATGGAGCCCCTCGGTTCTAA
--I--R--K--I--P--G--V--P--I--M--Y--I--S--N--H-----Y--N--I--E--R--M--P--D--D--Y--G--A--P--R--F--*-

Pig Consensus Sequence

>BGISUST0000889970
---GGGAAGCAAAAGAAAACACGGAAGTATGCTATCATGAAGCGAATGCTTAGTCTCAGAGATCAG------AAAGAAAAGGATAGATTAAAACCGAAAA
AGAAAGAAAAGAAAGATCCCAGTGCACTCAAGGAAAGAGAA---CCCCAACACCCTTCCTGCCTATTCTTCCAATATAATACACAGCTGGGCCCACCTTA
CCACATCCTGGTTGATACCAACTTTATCAACTTTTCCATTAAAGCCAAACTGGACTTAGTGCAGTCAATGATGGACTGTCTATATGCCAAG---ATCCCA
TGTATAACTGACTGTGTAATGGCTGAAATTGAGAAATTGGGGCAGAAGTATCGAGTGGCTCTA---ATTGACAAGGATCCAAGATTTGAACGATTACCCT
GCACACACAAAGGAACCTATGCAGATGACTGCTTAGTACAGAGAGTAACCCAGCACAAGTGTTACATTGTGGCCACAGTTGACCGGGACCTTAAACGAAG
AATCCGGAAGATCCCTGGAGTTCCCATCATGTACATTTCTAACCAT---TACAACATTGAGCGGATGCCCGATGATTATGGAGCCCCTCGGTTCTAA


>BGISUSP0000889970
-GKQKKTRKYAIMKRMLSLRDQ--KEKDRLKPKKKEKKDPSALKERE-PQHPSCLFFQYNTQLGPPYHILVDTNFINFSIKAKLDLVQSMMDCLYAK-IP
CITDCVMAEIEKLGQKYRVAL-IDKDPRFERLPCTHKGTYADDCLVQRVTQHKCYIVATVDRDLKRRIRKIPGVPIMYISNH-YNIERMPDDYGAPRF*