Sequences
EST Library Info
tes1Testes
Clusters
Oligos
SNPs

Gene ID ENSG00000119636 (click for geneview)
Transcript ID ENST00000238613(link to ensembl)
Symbol NP_079333.1
Localtion Chromosome:14:73582542:73602546:1 band: 14q24.3
Description  
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<------------------------------------------><-------------------------------------------------------
-K--I--I--M--L--A--E--R--A--H--H--E--A--I--V--Q--L--N--D--A--G--R--N--V--F--K--E--N--D--Y--L--Q--K--
AAGATAATAATGCTAGCAGAGAGAGCCCACCATGAGGCTATTGTGCAATTGAACGATGCTGGAAGAAATGTTTTTAAAGAGAATGATTATCTTCAGAAAG
                                             ::::::::..:::::::::::: ::::::::::::::::: ::::::.:::::::
---------------------------------------------CAATTGAATAATGCTGGAAGAACTGTTTTTAAAGAGAATGTTTATCTCCAGAAAG
----------------------------------------------Q--L--N--N--A--G--R--T--V--F--K--E--N--V--Y--L--Q--K--

----------------------------------------------------------------------------------------><----------
A--L--A--Y--H--L--K--E--T--D--A--L--Q--K--N--S--Q--K--L--Q--E--S--H--T--L--L--L--H--Q--K--E--I--N--D
CTCTGGCATATCACCTGAAGGAAACTGACGCTCTACAAAAAAACTCCCAGAAGTTGCAAGAGAGTCATACTTTACTTTTACATCAAAAGGAGATCAATGA
:::: :::::.::.:::::::::::.:::.::::.::::::::.:::::::::::.::::::: ::: :::::.:::::::: :::::::::::::::::
CTCTTGCATACCATCTGAAGGAAACCGACACTCTGCAAAAAAATTCCCAGAAGTTACAAGAGACTCAAACTTTGCTTTTACAGCAAAAGGAGATCAATGA
A--L--A--Y--H--L--K--E--T--D--T--L--Q--K--N--S--Q--K--L--Q--E--T--Q--T--L--L--L--Q--Q--K--E--I--N--D

----------------------------------------------------------------------------------------------------
--L--L--V--K--E--K--I--M--Q--L--V--Q--Q--R--S--Q--I--Q--T--L--Q--K--K--V--V--N--L--E--T--A--L--S--Y-
TCTGTTGGTTAAGGAAAAGATTATGCAACTTGTCCAGCAGAGATCACAAATCCAAACCCTTCAGAAGAAGGTAGTAAACTTGGAGACTGCTCTGAGTTAC
::::::::::::::::::::: :::::.:::..:::::::::::: :::::.::.::.:: :::::::::::.::::.::::::::::::.:::::::..
TCTGTTGGTTAAGGAAAAGATAATGCAGCTTACCCAGCAGAGATCCCAAATTCAGACTCTGCAGAAGAAGGTGGTAAGCTTGGAGACTGCCCTGAGTTGT
--L--L--V--K--E--K--I--M--Q--L--T--Q--Q--R--S--Q--I--Q--T--L--Q--K--K--V--V--S--L--E--T--A--L--S--C-

----------------------------------------------------------------------------------------------------
-M--T--K--E--F--E--S--E--V--L--K--L--Q--Q--H--A--M--I--E--N--Q--A--G--Q--V--E--I--D--K--L--Q--H--L--
ATGACCAAAGAGTTTGAGAGTGAAGTTTTAAAACTGCAGCAACACGCAATGATAGAGAACCAAGCAGGTCAGGTAGAAATTGACAAGCTGCAGCACCTTC
::::::::::::::::::: :::::::::::::::::::::.:: ::::::.:::::::::::::::::::..: ::::::  :::..::::::: ::::
ATGACCAAAGAGTTTGAGACTGAAGTTTTAAAACTGCAGCAGCAGGCAATGGTAGAGAACCAAGCAGGTCAAATTGAAATTTTCAAATTGCAGCAACTTC
-M--T--K--E--F--E--T--E--V--L--K--L--Q--Q--Q--A--M--V--E--N--Q--A--G--Q--I--E--I--F--K--L--Q--Q--L--

----------------------------------------------------------------------------------------------------
L--Q--M--K--D--R--E--M--N--R--V--K--K--L--A--K--N--I--L--D--E--R--T--E--V--E--R--F--F--L--D--A--L--H
TTCAGATGAAGGACAGGGAAATGAATCGTGTGAAGAAGCTGGCCAAGAACATACTGGATGAGAGAACAGAAGTGGAAAGATTCTTTTTAGATGCTCTGCA
:::::::::::::::::::::::::::: .:::::::::::::::::::::::::.::::::::::::::::::::::: :::::::::::::::::.::
TTCAGATGAAGGACAGGGAAATGAATCGAATGAAGAAGCTGGCCAAGAACATACTAGATGAGAGAACAGAAGTGGAAAGTTTCTTTTTAGATGCTCTACA
L--Q--M--K--D--R--E--M--N--R--M--K--K--L--A--K--N--I--L--D--E--R--T--E--V--E--S--F--F--L--D--A--L--H

----------------------------------------------------------------------------------------------------
--Q--V--K--Q--Q--I--L--I--S--R--K--H--Y--K--Q--I--A--Q--A--A--F--N--L--K--M--R--A--A--C--T--G--R--T-
CCAAGTGAAGCAACAGATCCTAATTAGCAGGAAGCATTATAAGCAGATAGCACAAGCTGCTTTCAATTTAAAAATGAGAGCAGCATGTACAGGAAGAACA
::::::.::::::::::::::.:.:::.::.::::.::::::.:::::::::::::::::::::::::: :::::::::: .::.:::.::.::::::::
CCAAGTAAAGCAACAGATCCTGACTAGTAGAAAGCGTTATAAACAGATAGCACAAGCTGCTTTCAATTTTAAAATGAGAGAGGCGTGTGCAAGAAGAACA
--Q--V--K--Q--Q--I--L--T--S--R--K--R--Y--K--Q--I--A--Q--A--A--F--N--F--K--M--R--E--A--C--A--R--R--T-

----------------------------------------------------------------------------------><----------------
-E--Y--P--K--I--R--T--F--D--G--R--E--H--S--T--N--S--V--N--Q--D--L--L--E--A--E--K--W--T--H--I--E--G--
GAATATCCCAAAATCAGAACATTTGATGGCAGAGAGCACAGCACCAATAGTGTGAATCAGGATCTTCTGGAGGCCGAAAAATGGACACATATTGAAGGAA
::::::::::::::: : :::::.:::::::::::::::::::::::::::::::::::::::::: :::::::.::       ::: ::.:: : ::::
GAATATCCCAAAATCCGCACATTCGATGGCAGAGAGCACAGCACCAATAGTGTGAATCAGGATCTTATGGAGGCTGAT------ACAGATGTTCATGGAA
-E--Y--P--K--I--R--T--F--D--G--R--E--H--S--T--N--S--V--N--Q--D--L--M--E--A--D--------T--D--V--H--G--

------------------------------------------------------------------------------------><--------------
N--V--D--I--G--D--L--T--W--E--Q--K--E--K--V--L--R--L--L--F--A--K--M--N--G--C--P--S--R--K--Y--N--Q--S
ATGTGGATATTGGAGATTTGACCTGGGAGCAGAAGGAAAAAGTATTGCGATTGCTCTTTGCAAAAATGAATGGCTGTCCTTCTAGGAAATACAACCAGAG
:::::::::::::::::::::::::::::::::::::.::::: ::: :.::::::::::::::::::::::::            :::::::.::::::
ATGTGGATATTGGAGATTTGACCTGGGAGCAGAAGGAGAAAGTCTTGAGGTTGCTCTTTGCAAAAATGAATGGC------------AAATACAGCCAGAG
N--V--D--I--G--D--L--T--W--E--Q--K--E--K--V--L--R--L--L--F--A--K--M--N--G--------------K--Y--S--Q--S

-----------------------------------------------------------><---------------------------------------
--S--R--P--P--V--P--D--Y--V--V--S--D--S--G--E--T--K--E--F--G--D--E--S--K--L--Q--D--K--I--F--I--T--Q-
TTCTAGGCCTCCAGTTCCAGACTATGTTGTTTCTGACAGTGGGGAAACAAAGGAATTTGGGGATGAAAGTAAGCTTCAAGATAAAATCTTCATCACCCAG
::::::.::::::::::::::::::::::::.. ::... ::..::.:::::::.:::   ::::::: :::::::: :::: :::.:::::::::::::
TTCTAGACCTCCAGTTCCAGACTATGTTGTTCTAGATGAAGGAAAAGCAAAGGAGTTT---GATGAAATTAAGCTTCCAGATCAAACCTTCATCACCCAG
--S--R--P--P--V--P--D--Y--V--V--L--D--E--G--K--A--K--E--F-----D--E--I--K--L--P--D--Q--T--F--I--T--Q-

--------------------------------------------------------------------------><---------->
-Q--I--A--I--S--D--S--S--G--E--V--V--L--P--T--I--P--K--E--P--Q--E--S--D--T--G--T--F--*-
CAAATTGCAATATCAGACTCTTCTGGTGAAGTGGTGCTACCCACTATTCCAAAAGAACCTCAGGAGTCTGACACAGGAACCTTCTGA
:::.:  :::: :..::::::::::::::: ::::: ::.::: ::::: .:: :::.: ::.:::::::::               
CAAGTGCCAATCTTGGACTCTTCTGGTGAACTGGTGATATCCAATATTCAGAATGAATCACAAGAGTCTGAC---------------
-Q--V--P--I--L--D--S--S--G--E--L--V--I--S--N--I--Q--N--E--S--Q--E--S--D----------------

Pig Consensus Sequence

>BGISUST0000894903
---------------------------------------------CAATTGAATAATGCTGGAAGAACTGTTTTTAAAGAGAATGTTTATCTCCAGAAAG
CTCTTGCATACCATCTGAAGGAAACCGACACTCTGCAAAAAAATTCCCAGAAGTTACAAGAGACTCAAACTTTGCTTTTACAGCAAAAGGAGATCAATGA
TCTGTTGGTTAAGGAAAAGATAATGCAGCTTACCCAGCAGAGATCCCAAATTCAGACTCTGCAGAAGAAGGTGGTAAGCTTGGAGACTGCCCTGAGTTGT
ATGACCAAAGAGTTTGAGACTGAAGTTTTAAAACTGCAGCAGCAGGCAATGGTAGAGAACCAAGCAGGTCAAATTGAAATTTTCAAATTGCAGCAACTTC
TTCAGATGAAGGACAGGGAAATGAATCGAATGAAGAAGCTGGCCAAGAACATACTAGATGAGAGAACAGAAGTGGAAAGTTTCTTTTTAGATGCTCTACA
CCAAGTAAAGCAACAGATCCTGACTAGTAGAAAGCGTTATAAACAGATAGCACAAGCTGCTTTCAATTTTAAAATGAGAGAGGCGTGTGCAAGAAGAACA
GAATATCCCAAAATCCGCACATTCGATGGCAGAGAGCACAGCACCAATAGTGTGAATCAGGATCTTATGGAGGCTGAT------ACAGATGTTCATGGAA
ATGTGGATATTGGAGATTTGACCTGGGAGCAGAAGGAGAAAGTCTTGAGGTTGCTCTTTGCAAAAATGAATGGC------------AAATACAGCCAGAG
TTCTAGACCTCCAGTTCCAGACTATGTTGTTCTAGATGAAGGAAAAGCAAAGGAGTTT---GATGAAATTAAGCTTCCAGATCAAACCTTCATCACCCAG
CAAGTGCCAATCTTGGACTCTTCTGGTGAACTGGTGATATCCAATATTCAGAATGAATCACAAGAGTCTGAC---------------


>BGISUSP0000894903
---------------QLNNAGRTVFKENVYLQKALAYHLKETDTLQKNSQKLQETQTLLLQQKEINDLLVKEKIMQLTQQRSQIQTLQKKVVSLETALSC
MTKEFETEVLKLQQQAMVENQAGQIEIFKLQQLLQMKDREMNRMKKLAKNILDERTEVESFFLDALHQVKQQILTSRKRYKQIAQAAFNFKMREACARRT
EYPKIRTFDGREHSTNSVNQDLMEAD--TDVHGNVDIGDLTWEQKEKVLRLLFAKMNG----KYSQSSRPPVPDYVVLDEGKAKEF-DEIKLPDQTFITQ
QVPILDSSGELVISNIQNESQESD-----