Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000119660 (click for geneview)
Transcript ID ENST00000238638(link to ensembl)
Symbol O95431_HUMAN
Localtion Chromosome:14:74828562:74830769:-1 band: 14q24.3
Description Hypothetical protein.
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--G--R--A--E--A--A--G--R--R--H--G--A--G--W--G--P--R--C--G--A-----V--T--G--V--A--D--G--A--Y--V--S--
ATGGGCAGAGCGGAAGCGGCGGGCCGGCGTCACGGCGCCGGGTGGGGGCCGCGCTGCGGGGCG---GTGACGGGAGTCGCTGACGGCGCCTACGTGTCAC
::::::::::::::::::.:::.: :.:::::::::::::::.:::: ::::::::::::::.   .::::: ::: :::::::::::::::::::::::
ATGGGCAGAGCGGAAGCGACGGACAGACGTCACGGCGCCGGGCGGGGTCCGCGCTGCGGGGCAG--ATGACGCGAGGCGCTGACGGCGCCTACGTGTCAC
-M--G--R--A--E--A--T--D--R--R--H--G--A--G--R--G--P--R--C--G--A--\--V--T--R--G--A--D--G--A--Y--V--S--

---------------------------------------------><-----------------------------------------------------
P--W--K--P--N--S--K--Q--R--T--R--E--L--L--A--P--R--P--V--W--I--I--P--Y--I--E--Q--M--S--K--A--M--L--Q
CGTGGAAACCAAACAGTAAACAGAGGACTCGCGAGCTCCTGGCACCCAGGCCCGTATGGATAATCCCTTACATCGAGCAGATGAGCAAGGCCATGCTCCA
:.::::::::::::::::::.:::::.::.:.::::::::::::                                          ::.:..:::::: :
CATGGAAACCAAACAGTAAATAGAGGGCTTGTGAGCTCCTGGCA------------------------------------------AAAGTTATGCTCGA
P--W--K--P--N--S--K--*--R--A--C--E--L--L--A--------------------------------------------K--V--M--L--E

----------------------------------------------------------------------------------------------------
--L--K--A--L--E--S--S--D--L--T--E--V--V--V--Y--S--S--Y--W--Y--K--L--Q--T--K--W--M--L--Q--S--M--A--E-
GCTGAAGGCTCTGGAGTCTTCAGACCTCACCGAGGTCGTGGTTTACAGCTCCTATTGGTACAAGCTCCAAACCAAGTGGATGCTCCAGTCCATGGCTGAG
: :::::::::::::.:::::.:::::::::::.:::.::::::::.:..:.::.: :::::::.:::..::::::::::::::::::::.::::: :::
GATGAAGGCTCTGGAATCTTCGGACCTCACCGAAGTCATGGTTTACGGTCCTTACTTGTACAAGTTCCGGACCAAGTGGATGCTCCAGTCTATGGCAGAG
--M--K--A--L--E--S--S--D--L--T--E--V--M--V--Y--G--P--Y--L--Y--K--F--R--T--K--W--M--L--Q--S--M--A--E-

----------------------------------------------------------------------------------------------------
-W--H--C--Q--H--Q--E--Q--G--M--L--K--L--A--E--A--M--N--A--L--K--L--D--P--W--M--K--R--T--S--F--R--P--
TGGCACTGCCAGCACCAGGAGCAAGGGATGCTCAAACTTGCAGAAGCCATGAATGCCCTCAAACTAGACCCTTGGATGAAGCGAACCAGCTTCCGGCCAA
:::::::::::::..:::::.:.:::::::: ::.::::: .:::::::::::: : ::..:.::: ..:::. :::::::.::: ::.:          
TGGCACTGCCAGCGTCAGGAACGAGGGATGCGCAGACTTGAGGAAGCCATGAATTCACTTGAGCTATGTCCTCCGATGAAGTGAAGCAAC----------
-W--H--C--Q--R--Q--E--R--G--M--R--R--L--E--E--A--M--N--S--L--E--L--C--P--P--M--K--*--S--N-----------

---->
M--*-
TGTGA
     
-----
-----

Pig Consensus Sequence

>BGISUST0000897909
ATGGGCAGAGCGGAAGCGACGGACAGACGTCACGGCGCCGGGCGGGGTCCGCGCTGCGGGGCaaTGACGCGAGGCGCTGACGGCGCCTACGTGTCACCAT
GGAAACCAAACAGTAAATAGAGGGCTTGTGAGCTCCTGGCA------------------------------------------AAAGTTATGCTCGAGAT
GAAGGCTCTGGAATCTTCGGACCTCACCGAAGTCATGGTTTACGGTCCTTACTTGTACAAGTTCCGGACCAAGTGGATGCTCCAGTCTATGGCAGAGTGG
CACTGCCAGCGTCAGGAACGAGGGATGCGCAGACTTGAGGAAGCCATGAATTCACTTGAGCTATGTCCTCCGATGAAGTGAAGCAAC-------------
--


>BGISUSP0000897909
MGRAEATDRRHGAGRGPRCGAMTRGADGAYVSPWKPNSK*RACELLA--------------KVMLEMKALESSDLTEVMVYGPYLYKFRTKWMLQSMAEW
HCQRQERGMRRLEEAMNSLELCPPMK*SN-----