Sequences
EST Library Info
plac2Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000119699 (click for geneview)
Transcript ID ENST00000238682(link to ensembl)
Symbol TGFB3
Localtion Chromosome:14:75494195:75517242:-1 band: 14q24.3
Description Transforming growth factor beta 3 precursor (TGF-beta 3). [Source:Uniprot/SWISSPROT;Acc:P10600]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--K--M--H--L--Q--R--A--L--V--V--L--A--L--L--N--F--A--T--V--S--L--S--L--S--T--C--T--T--L--D--F--G--
ATGAAGATGCACTTGCAAAGGGCTCTGGTGGTCCTGGCCCTGCTGAACTTTGCCACGGTCAGCCTCTCTCTGTCCACTTGCACCACCTTGGACTTCGGCC
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::. :::::::::::::::::::::::::::.::
ATGAAGATGCACTTGCAAAGGGCTCTGGTGGTCCTGGCCCTGCTGAACTTTGCCACGGTCAGCCTCTCCATGTCCACTTGCACCACCTTGGACTTCGACC
-M--K--M--H--L--Q--R--A--L--V--V--L--A--L--L--N--F--A--T--V--S--L--S--M--S--T--C--T--T--L--D--F--D--

----------------------------------------------------------------------------------------------------
H--I--K--K--K--R--V--E--A--I--R--G--Q--I--L--S--K--L--R--L--T--S--P--P--E--P--T--V--M--T--H--V--P--Y
ACATCAAGAAGAAGAGGGTGGAAGCCATTAGGGGACAGATCTTGAGCAAGCTCAGGCTCACCAGCCCCCCTGAGCCAACGGTGATGACCCACGTCCCCTA
:::::::::.:::::::::::::::::::::::::::::::::::::::.::::::::::::::.:::::.:: ::: ::.:: ::.:: ::.:::::  
ACATCAAGAGGAAGAGGGTGGAAGCCATTAGGGGACAGATCTTGAGCAAACTCAGGCTCACCAGTCCCCCCGATCCATCGATGTTGGCCAACATCCCCAC
H--I--K--R--K--R--V--E--A--I--R--G--Q--I--L--S--K--L--R--L--T--S--P--P--D--P--S--M--L--A--N--I--P--T

----------------------------------------------------------------------------------------------------
--Q--V--L--A--L--Y--N--S--T--R--E--L--L--E--E--M--H--G--E--R--E--E--G--C--T--Q--E--N--T--E--S--E--Y-
TCAGGTCCTGGCCCTTTACAACAGCACCCGGGAGCTGCTGGAGGAGATGCATGGGGAGAGGGAGGAAGGCTGCACCCAGGAAAACACCGAGTCGGAATAC
.:::::::::: ::::::::::::::::::::::::::::::::::.::::.::::::::::..:: :.::::::.::::::::::::::::::::.:::
CCAGGTCCTGGACCTTTACAACAGCACCCGGGAGCTGCTGGAGGAGGTGCACGGGGAGAGGGGAGACGACTGCACTCAGGAAAACACCGAGTCGGAGTAC
--Q--V--L--D--L--Y--N--S--T--R--E--L--L--E--E--V--H--G--E--R--G--D--D--C--T--Q--E--N--T--E--S--E--Y-

---------------------------------------------------><-----------------------------------------------
-Y--A--K--E--I--H--K--F--D--M--I--Q--G--L--A--E--H--N--E--L--A--V--C--P--K--G--I--T--S--K--V--F--R--
TATGCCAAAGAAATCCATAAATTCGACATGATCCAGGGGCTGGCGGAGCACAACGAACTGGCTGTCTGCCCTAAAGGAATTACCTCCAAGGTTTTCCGCT
::::::::.::::::.::::::::::::::::::::::::::: :::::::   :: :::::.::.:::::.::::::::.:::::::::.:::::::::
TATGCCAAGGAAATCTATAAATTCGACATGATCCAGGGGCTGGAGGAGCAC---GATCTGGCCGTTTGCCCCAAAGGAATCACCTCCAAGATTTTCCGCT
-Y--A--K--E--I--Y--K--F--D--M--I--Q--G--L--E--E--H-----D--L--A--V--C--P--K--G--I--T--S--K--I--F--R--

----------------------------------------------------------------------------------------------------
F--N--V--S--S--V--E--K--N--R--T--N--L--F--R--A--E--F--R--V--L--R--V--P--N--P--S--S--K--R--N--E--Q--R
TCAATGTGTCCTCAGTGGAGAAAAATAGAACCAACCTATTCCGAGCAGAATTCCGGGTCTTGCGGGTGCCCAACCCCAGCTCTAAGCGGAATGAGCAGAG
::::.::::: ::::::::::::::...:::::::::.:::::.:::::::::::::::::::::.::::::::::::::::.::::: :..::::::::
TCAACGTGTCGTCAGTGGAGAAAAACGAAACCAACCTGTTCCGGGCAGAATTCCGGGTCTTGCGGATGCCCAACCCCAGCTCCAAGCGCAGCGAGCAGAG
F--N--V--S--S--V--E--K--N--E--T--N--L--F--R--A--E--F--R--V--L--R--M--P--N--P--S--S--K--R--S--E--Q--R

---------------><-----------------------------------------------------------------------------------
--I--E--L--F--Q--I--L--R--P--D--E--H--I--A--K--Q--R--Y--I--G--G--K--N--L--P--T--R--G--T--A--E--W--L-
GATCGAGCTCTTCCAGATCCTTCGGCCAGATGAGCACATTGCCAAACAGCGCTATATCGGTGGCAAGAATCTGCCCACACGGGGCACTGCCGAGTGGCTG
:::.:::::::::::::::::.:.::: ::::::::::: :::::.::::::::.::::..::::::::.::::::::.:::::..:.::::::::::::
GATTGAGCTCTTCCAGATCCTCCAGCCCGATGAGCACATAGCCAAGCAGCGCTACATCGACGGCAAGAACCTGCCCACGCGGGGTGCCGCCGAGTGGCTG
--I--E--L--F--Q--I--L--Q--P--D--E--H--I--A--K--Q--R--Y--I--D--G--K--N--L--P--T--R--G--A--A--E--W--L-

---------------------------------------------><-----------------------------------------------------
-S--F--D--V--T--D--T--V--R--E--W--L--L--R--R--E--S--N--L--G--L--E--I--S--I--H--C--P--C--H--T--F--Q--
TCCTTTGATGTCACTGACACTGTGCGTGAGTGGCTGTTGAGAAGAGAGTCCAACTTAGGTCTAGAAATCAGCATTCACTGTCCATGTCACACCTTTCAGC
:::::.::.::::: ::::::::::::::.::::: :::::::::   ::::::::.:::::.::::::::::::::.:::::.::::::::::::::::
TCCTTCGACGTCACAGACACTGTGCGTGAATGGCTCTTGAGAAGA---TCCAACTTGGGTCTGGAAATCAGCATTCATTGTCCGTGTCACACCTTTCAGC
-S--F--D--V--T--D--T--V--R--E--W--L--L--R--R-----S--N--L--G--L--E--I--S--I--H--C--P--C--H--T--F--Q--

-----------------------------------------------------><---------------------------------------------
P--N--G--D--I--L--E--N--I--H--E--V--M--E--I--K--F--K--G--V--D--N--E--D--D--H--G--R--G--D--L--G--R--L
CCAATGGAGATATCCTGGAAAACATTCACGAGGTGATGGAAATCAAATTCAAAGGCGTGGACAATGAGGATGACCATGGCCGTGGAGATCTGGGGCGCCT
::::.::.::::::.::::::::::::: ::::::::::::::::::::::::   :::::::.:::::::::.:  :::::::::::.:::::::: ::
CCAACGGGGATATCTTGGAAAACATTCAAGAGGTGATGGAAATCAAATTCAAA---GTGGACAGTGAGGATGATCCGGGCCGTGGAGACCTGGGGCGACT
P--N--G--D--I--L--E--N--I--Q--E--V--M--E--I--K--F--K-----V--D--S--E--D--D--P--G--R--G--D--L--G--R--L

----------------------------------------------------------------------------------------------------
--K--K--Q--K--D--H--H--N--P--H--L--I--L--M--M--I--P--P--H--R--L--D--N--P--G--Q--G--G--Q--R--K--K--R-
CAAGAAGCAGAAGGATCACCACAACCCTCATCTAATCCTCATGATGATTCCCCCACACCGGCTCGACAACCCGGGCCAGGGGGGTCAGAGGAAGAAGCGG
.:::::: :::::::    ::::.:::::::::::::::::::::::::::.::: ::::::: ::::::::.:::: ::::: ::::::::::::::::
TAAGAAGAAGAAGGAA---CACAGCCCTCATCTAATCCTCATGATGATTCCTCCAGACCGGCTAGACAACCCAGGCCTGGGGGCTCAGAGGAAGAAGCGG
--K--K--K--K--E-----H--S--P--H--L--I--L--M--M--I--P--P--D--R--L--D--N--P--G--L--G--A--Q--R--K--K--R-

-------------------------><-------------------------------------------------------------------------
-A--L--D--T--N--Y--C--F--R--N--L--E--E--N--C--C--V--R--P--L--Y--I--D--F--R--Q--D--L--G--W--K--W--V--
GCTTTGGACACCAATTACTGCTTCCGCAACTTGGAGGAGAACTGCTGTGTGCGCCCCCTCTACATTGACTTCCGACAGGATCTGGGCTGGAAGTGGGTCC
::..::::::::::.:::::::::   ::.::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::
GCCCTGGACACCAACTACTGCTTC---AATTTGGAGGAGAACTGCTGTGTGCGCCCTCTCTACATTGACTTCCGACAGGATCTGGGCTGGAAGTGGGTCC
-A--L--D--T--N--Y--C--F-----N--L--E--E--N--C--C--V--R--P--L--Y--I--D--F--R--Q--D--L--G--W--K--W--V--

-------------------------------------------------------------------------------><-------------------
H--E--P--K--G--Y--Y--A--N--F--C--S--G--P--C--P--Y--L--R--S--A--D--T--T--H--S--T--V--L--G--L--Y--N--T
ATGAACCTAAGGGCTACTATGCCAACTTCTGCTCAGGCCCTTGCCCATACCTCCGCAGTGCAGACACAACCCACAGCACGGTGCTGGGACTGTACAACAC
::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::: ::::::::::.:::::::::::
ATGAACCTAAGGGCTACTATGCCAACTTCTGCTCAGGCCCTTGCCCGTACCTCCGCAGTGCAGACACAACCCACAGCTCGGTGCTGGGGCTGTACAACAC
H--E--P--K--G--Y--Y--A--N--F--C--S--G--P--C--P--Y--L--R--S--A--D--T--T--H--S--S--V--L--G--L--Y--N--T

----------------------------------------------------------------------------------------------------
--L--N--P--E--A--S--A--S--P--C--C--V--P--Q--D--L--E--P--L--T--I--L--Y--Y--V--G--R--T--P--K--V--E--Q-
TCTGAACCCTGAAGCATCTGCCTCGCCTTGCTGCGTGCCCCAGGACCTGGAGCCCCTGACCATCCTGTACTATGTTGGGAGGACCCCCAAAGTGGAGCAG
.::::::::.::::: :: ::::: :: ::::::::::::::::::::::::::::::::::::::::::::.::.::::::::: ::::.:::::::::
CCTGAACCCCGAAGCCTCGGCCTCTCCGTGCTGCGTGCCCCAGGACCTGGAGCCCCTGACCATCCTGTACTACGTCGGGAGGACCGCCAAGGTGGAGCAG
--L--N--P--E--A--S--A--S--P--C--C--V--P--Q--D--L--E--P--L--T--I--L--Y--Y--V--G--R--T--A--K--V--E--Q-

-------------------------------------->
-L--S--N--M--V--V--K--S--C--K--C--S--*-
CTCTCCAACATGGTGGTGAAGTCTTGTAAATGTAGCTGA
:::::.:::::::::::::::::.::.::.::.::::::
CTCTCTAACATGGTGGTGAAGTCCTGCAAGTGCAGCTGA
-L--S--N--M--V--V--K--S--C--K--C--S--*-

Pig Consensus Sequence

>BGISUST0000902056
ATGAAGATGCACTTGCAAAGGGCTCTGGTGGTCCTGGCCCTGCTGAACTTTGCCACGGTCAGCCTCTCCATGTCCACTTGCACCACCTTGGACTTCGACC
ACATCAAGAGGAAGAGGGTGGAAGCCATTAGGGGACAGATCTTGAGCAAACTCAGGCTCACCAGTCCCCCCGATCCATCGATGTTGGCCAACATCCCCAC
CCAGGTCCTGGACCTTTACAACAGCACCCGGGAGCTGCTGGAGGAGGTGCACGGGGAGAGGGGAGACGACTGCACTCAGGAAAACACCGAGTCGGAGTAC
TATGCCAAGGAAATCTATAAATTCGACATGATCCAGGGGCTGGAGGAGCAC---GATCTGGCCGTTTGCCCCAAAGGAATCACCTCCAAGATTTTCCGCT
TCAACGTGTCGTCAGTGGAGAAAAACGAAACCAACCTGTTCCGGGCAGAATTCCGGGTCTTGCGGATGCCCAACCCCAGCTCCAAGCGCAGCGAGCAGAG
GATTGAGCTCTTCCAGATCCTCCAGCCCGATGAGCACATAGCCAAGCAGCGCTACATCGACGGCAAGAACCTGCCCACGCGGGGTGCCGCCGAGTGGCTG
TCCTTCGACGTCACAGACACTGTGCGTGAATGGCTCTTGAGAAGA---TCCAACTTGGGTCTGGAAATCAGCATTCATTGTCCGTGTCACACCTTTCAGC
CCAACGGGGATATCTTGGAAAACATTCAAGAGGTGATGGAAATCAAATTCAAA---GTGGACAGTGAGGATGATCCGGGCCGTGGAGACCTGGGGCGACT
TAAGAAGAAGAAGGAACACAGCCCTCATCTAATCCTCATGATGATTCCTCCAGACCGGCTAGACAACCCAGGCCTGGGGGCTCAGAGGAAGAAGCGGGCC
CTGGACACCAACTACTGCTTC---AATTTGGAGGAGAACTGCTGTGTGCGCCCTCTCTACATTGACTTCCGACAGGATCTGGGCTGGAAGTGGGTCCATG
AACCTAAGGGCTACTATGCCAACTTCTGCTCAGGCCCTTGCCCGTACCTCCGCAGTGCAGACACAACCCACAGCTCGGTGCTGGGGCTGTACAACACCCT
GAACCCCGAAGCCTCGGCCTCTCCGTGCTGCGTGCCCCAGGACCTGGAGCCCCTGACCATCCTGTACTACGTCGGGAGGACCGCCAAGGTGGAGCAGCTC
TCTAACATGGTGGTGAAGTCCTGCAAGTGCAGCTGA


>BGISUSP0000902056
MKMHLQRALVVLALLNFATVSLSMSTCTTLDFDHIKRKRVEAIRGQILSKLRLTSPPDPSMLANIPTQVLDLYNSTRELLEEVHGERGDDCTQENTESEY
YAKEIYKFDMIQGLEEH-DLAVCPKGITSKIFRFNVSSVEKNETNLFRAEFRVLRMPNPSSKRSEQRIELFQILQPDEHIAKQRYIDGKNLPTRGAAEWL
SFDVTDTVREWLLRR-SNLGLEISIHCPCHTFQPNGDILENIQEVMEIKFK-VDSEDDPGRGDLGRLKKKKEHSPHLILMMIPPDRLDNPGLGAQRKKRA
LDTNYCF-NLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHSSVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTAKVEQL
SNMVVKSCKCS*