Sequences
EST Library Info
amn3Amnion
cki1Kidney - RNA from China
cli1Liver - RNA from China
cov2Ovary - RNA from China
cut1Uterus - RNA from China
dbla2Unavailable
ebs1Foetus 50 days, brain stem
eep2Foetus 50 days, epidermis
fat1Fatt
fhi2Unavailable
gul1Gullet
hyp4Hypothalamus
lnt1Lymphatic nodule tracheobroncalis
med2Mediastinum
mga1Mammary gland - 7 days after weaning
mgm1Mammary gland - 14 days after birth
nca1Newborn 115 days, cartillage
nco2Newborn 115 days, colon
nje1Newborn 115 days, jejunum
ova1Ovary
pan1Pancreas
pgl1Pituitary gland
pldo4Unavailable
pliv1Unavailable
ret1Retina
sin1Small intestine
sme1M. Semimembranosus
spc2Spinal cord
ssp1M. Supraspinatus
ste1M. Semitendinosus
sto1Stomach
ton3Tip of tongue, mucosal membrane
tra1Trachea
Clusters
Oligos
SNPs

Gene ID ENSG00000114354 (click for geneview)
Transcript ID ENST00000240851(link to ensembl)
Symbol TFG
Localtion Chromosome:3:101910959:101950497:1 band: 3q12.2
Description TFG protein (TRK-fused gene protein). [Source:Uniprot/SWISSPROT;Acc:Q92734]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--N--G--Q--L--D--L--S--G--K--L--I--I--K--A--Q--L--G--E--D--I--R--R--I--P--I--H--N--E--D--I--T--Y--
ATGAACGGACAGTTGGATCTAAGTGGGAAGCTAATCATCAAAGCTCAACTTGGGGAGGATATTCGGCGAATTCCTATTCATAATGAAGATATTACTTATG
:::::.::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::.:::::::: :::::::::::::::::::::::::
ATGAATGGACAGTTGGATCTGAGTGGGAAGCTAATCATCAAAGCTCAACTTGGGGAGGATATTCGACGAATTCC-ATTCATAATGAAGATATTACTTATG
-M--N--G--Q--L--D--L--S--G--K--L--I--I--K--A--Q--L--G--E--D--I--R--R--I--P--I--H--N--E--D--I--T--Y--

--------------------------------------------------------------------------------------><------------
D--E--L--V--L--M--M--Q--R--V--F--R--G--K--L--L--S--N--D--E--V--T--I--K--Y--K--D--E--D--G--D--L--I--T
ATGAATTAGTGCTAATGATGCAACGAGTTTTCAGAGGAAAACTTCTGAGTAATGATGAAGTAACAATAAAGTATAAAGATGAAGATGGAGATCTTATAAC
::::::::::::::::::::::: ::::.:::::::::::::::::::::::::::::::: ::::::::.::::::::::::   ::::::::::::::
ATGAATTAGTGCTAATGATGCAAAGAGTCTTCAGAGGAAAACTTCTGAGTAATGATGAAGTTACAATAAAATATAAAGATGAA---GGAGATCTTATAAC
D--E--L--V--L--M--M--Q--R--V--F--R--G--K--L--L--S--N--D--E--V--T--I--K--Y--K--D--E-----G--D--L--I--T

----------------------------------------------------------------------><----------------------------
--I--F--D--S--S--D--L--S--F--A--I--Q--C--S--R--I--L--K--L--T--L--F--V--N--G--Q--P--R--P--L--E--S--S-
AATTTTTGATAGTTCTGACCTTTCCTTTGCAATTCAGTGCAGTAGGATACTGAAACTGACATTATTTGTTAATGGCCAGCCAAGACCCCTTGAATCAAGT
:::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::      :::::.::.:::::::::::::::::::::
AATTTTTGATAGTTCTGACCTTTCCTTTGCAATTCAGTGTAGTAGGATACTGAAACTGACATTA------AATGGTCAACCAAGACCCCTTGAATCAAGT
--I--F--D--S--S--D--L--S--F--A--I--Q--C--S--R--I--L--K--L--T--L--------N--G--Q--P--R--P--L--E--S--S-

----------------------------------------------------------------------------------------------------
-Q--V--K--Y--L--R--R--E--L--I--E--L--R--N--K--V--N--R--L--L--D--S--L--E--P--P--G--E--P--G--P--S--T--
CAGGTGAAATATCTCCGTCGAGAACTGATAGAACTTCGAAATAAAGTGAATCGTTTATTGGATAGCTTGGAACCACCTGGAGAACCAGGACCTTCCACCA
::.::::::::::: ::::::::::::::::::::::::::::::::::::::.::.:::::::::::::::::.::::::::::::::::: :::::::
CAAGTGAAATATCTACGTCGAGAACTGATAGAACTTCGAAATAAAGTGAATCGCTTGTTGGATAGCTTGGAACCGCCTGGAGAACCAGGACCGTCCACCA
-Q--V--K--Y--L--R--R--E--L--I--E--L--R--N--K--V--N--R--L--L--D--S--L--E--P--P--G--E--P--G--P--S--T--

-----------------><---------------------------------------------------------------------------------
N--I--P--E--N--D--T--V--D--G--R--E--E--K-----S--A--S--D--S--S--G--K--Q--S--T--Q--V--M--A--A--S--M--S
ATATTCCTGAAAATGATACTGTGGATGGTAGGGAAGAAAAG---TCTGCTTCTGATTCTTCTGGAAAACAGTCTACTCAGGTTATGGCAGCAAGTATGTC
:.::: ::::::::   ::::::::::::::::::::::::    ::::::::::::::::::::::::::::::::::::: :::::::::::::::::
ACATTACTGAAAAT---ACTGTGGATGGTAGGGAAGAAAAGCCTGCTGCTTCTGATTCTTCTGGAAAACAGTCTACTCAGGTGATGGCAGCAAGTATGTC
N--I--T--E--N-----T--V--D--G--R--E--E--K--P--A--A--S--D--S--S--G--K--Q--S--T--Q--V--M--A--A--S--M--S

-------------------------------------------------------------------------------------><-------------
--A--F--D--P--L--K--N--Q--D--E--I--N--K--N--V--M--S--A--F--G--L--T--D--D--Q--V--S--G--P--P--S--A--P-
TGCTTTTGATCCTTTAAAAAACCAAGATGAAATCAATAAAAATGTTATGTCAGCGTTTGGCTTAACAGATGATCAGGTTTCAGGGCCACCCAGTGCTCCT
 ::::::::::::::::::::::::::::::::::::::::::::.::::::::.::::::.::::::::::::::::::::   :::::::::::::::
AGCTTTTGATCCTTTAAAAAACCAAGATGAAATCAATAAAAATGTCATGTCAGCATTTGGCCTAACAGATGATCAGGTTTCA---CCACCCAGTGCTCCT
--A--F--D--P--L--K--N--Q--D--E--I--N--K--N--V--M--S--A--F--G--L--T--D--D--Q--V--S-----P--P--S--A--P-

----------------------------------------------------------------------------------------------------
-A--E--D--R--S--G--T--P--D--S--I--A--S--S--S--S--A--A--H--P--P--G--V--Q--P--Q--Q--P--P--Y--T--G--A--
GCAGAAGATCGTTCAGGAACACCCGACAGCATTGCTTCCTCCTCCTCAGCAGCTCACCCACCAGGCGTTCAGCCACAGCAGCCACCATATACAGGAGCTC
::::::::.::::::::::: :::::::::::::::::.:::::::: ::::::::::::::::: ::::::::::::::::::::::::::::::::::
GCAGAAGACCGTTCAGGAACTCCCGACAGCATTGCTTCTTCCTCCTCTGCAGCTCACCCACCAGGAGTTCAGCCACAGCAGCCACCATATACAGGAGCTC
-A--E--D--R--S--G--T--P--D--S--I--A--S--S--S--S--A--A--H--P--P--G--V--Q--P--Q--Q--P--P--Y--T--G--A--

--------------------------><------------------------------------------------------------------------
Q--T--Q--A--G--Q--I--E--G--Q--M--Y--Q--Q--Y--Q--Q--Q--A--G--Y--G--A--Q--Q--P--Q--A--P--P--Q--Q--P--Q
AGACTCAAGCAGGTCAGATTGAAGGTCAGATGTACCAACAGTACCAGCAACAGGCCGGCTATGGTGCACAGCAGCCGCAGGCTCCACCTCAGCAGCCTCA
 ::::::::::::::::: ::::   :::::::::::.::::::: :::.:::::.::::::::..: ::::::::.::::: ::.::.:::: ::: ::
TGACTCAAGCAGGTCAGAGTGAA---CAGATGTACCAGCAGTACCCGCAGCAGGCTGGCTATGGCACTCAGCAGCCACAGGCGCCGCCCCAGCCGCCACA
L--T--Q--A--G--Q--S--E-----Q--M--Y--Q--Q--Y--P--Q--Q--A--G--Y--G--T--Q--Q--P--Q--A--P--P--Q--P--P--Q

-------------------------><-------------------------------------------------------------------------
--Q--Y--G--I--Q--Y--S--A--S--Y--S--Q--Q--T--G--P--Q--Q--P--Q--Q--F--Q--G--Y--G--Q--Q--P--T--S--Q--A-
ACAGTATGGTATTCAGTATTCAGCAAGCTATAGTCAGCAGACTGGACCTCAACAACCTCAGCAGTTCCAGGGATATGGCCAGCAACCAACTTCCCAGGCA
.:::::.:::::::::::::::   .::::::::::::::::.:::::.:::::::::::::::::::::::::::::::::::::::::::::::::::
GCAGTACGGTATTCAGTATTCA---GGCTATAGTCAGCAGACCGGACCCCAACAACCTCAGCAGTTCCAGGGATATGGCCAGCAACCAACTTCCCAGGCA
--Q--Y--G--I--Q--Y--S-----G--Y--S--Q--Q--T--G--P--Q--Q--P--Q--Q--F--Q--G--Y--G--Q--Q--P--T--S--Q--A-

----------------------------------------------------------------------------------------------------
-P--A--P--A--F--S--G--Q--P--Q--Q--L--P--A--Q--P--P--Q--Q--Y--Q--A--S--N--Y--P--A--Q--T--Y--T--A--Q--
CCAGCTCCTGCCTTTTCTGGTCAGCCTCAACAACTGCCTGCTCAGCCGCCACAGCAGTACCAGGCGAGCAATTATCCTGCACAAACTTACACTGCCCAAA
::.:::::::::::::::::.::::::::.::. ::::::::::.::.::::::::::::::::::::::.:::.::: ::::.:::::::::.::::.:
CCGGCTCCTGCCTTTTCTGGCCAGCCTCAGCAGATGCCTGCTCAACCACCACAGCAGTACCAGGCGAGCAGTTACCCTCCACAGACTTACACTACCCAGA
-P--A--P--A--F--S--G--Q--P--Q--Q--M--P--A--Q--P--P--Q--Q--Y--Q--A--S--S--Y--P--P--Q--T--Y--T--T--Q--

----------------------------------------------------------------------------------------------------
T--S--Q--P--T--N--Y--T--V--A--P--A--S--Q--P--G--M--A--P--S--Q--P--G--A--Y--Q--P--R--P--G--F--T--S--L
CTTCTCAGCCTACTAATTATACTGTGGCTCCTGCCTCTCAACCTGGAATGGCTCCAAGCCAACCTGGGGCCTATCAACCAAGACCAGGTTTTACTTCACT
::::.::::::::::::::.::::::::.:::::::: ::::::::::::::::::::::::::.:::::::::::.:: :::::::::::::::.:::.
CTTCCCAGCCTACTAATTACACTGTGGCCCCTGCCTCACAACCTGGAATGGCTCCAAGCCAACCCGGGGCCTATCAGCCCAGACCAGGTTTTACTCCACC
T--S--Q--P--T--N--Y--T--V--A--P--A--S--Q--P--G--M--A--P--S--Q--P--G--A--Y--Q--P--R--P--G--F--T--P--P

----------------------------------------------------------------------------------------------------
--P--G--S--T--M--T--P--P--P--S--G--P--N--P--Y--A--R--N--R--P--P--F--G--Q--G--Y--T--Q--P--G--P--G--Y-
TCCTGGAAGTACCATGACCCCTCCTCCAAGTGGGCCTAATCCTTATGCGCGTAACCGTCCTCCCTTTGGTCAGGGCTATACCCAACCTGGACCTGGTTAT
:::::::::::::::::::::::.::::::::::.::::.::::::::.::::.::::::::::::::::::::::::::::::::::::::: :::::.
TCCTGGAAGTACCATGACCCCTCTTCCAAGTGGGTCTAACCCTTATGCACGTAGCCGTCCTCCCTTTGGTCAGGGCTATACCCAACCTGGACCAGGTTAC
--P--G--S--T--M--T--P--L--P--S--G--S--N--P--Y--A--R--S--R--P--P--F--G--Q--G--Y--T--Q--P--G--P--G--Y-

------
-R--*-
CGATAA
::::::
CGATAA
-R--*-

Pig Consensus Sequence

>BGISUST0000897204
ATGAATGGACAGTTGGATCTGAGTGGGAAGCTAATCATCAAAGCTCAACTTGGGGAGGATATTCGACGAATtaTTCATAATGAAGATATTACTTATGATG
AATTAGTGCTAATGATGCAAAGAGTCTTCAGAGGAAAACTTCTGAGTAATGATGAAGTTACAATAAAATATAAAGATGAA---GGAGATCTTATAACAAT
TTTTGATAGTTCTGACCTTTCCTTTGCAATTCAGTGTAGTAGGATACTGAAACTGACATTA------AATGGTCAACCAAGACCCCTTGAATCAAGTCAA
GTGAAATATCTACGTCGAGAACTGATAGAACTTCGAAATAAAGTGAATCGCTTGTTGGATAGCTTGGAACCGCCTGGAGAACCAGGACCGTCCACCAACA
TTACTGAAAAT---ACTGTGGATGGTAGGGAAGAAAAGCCTGCTGCTTCTGATTCTTCTGGAAAACAGTCTACTCAGGTGATGGCAGCAAGTATGTCAGC
TTTTGATCCTTTAAAAAACCAAGATGAAATCAATAAAAATGTCATGTCAGCATTTGGCCTAACAGATGATCAGGTT---CCACCCAGTGCTCCTGCAGAA
GACCGTTCAGGAACTCCCGACAGCATTGCTTCTTCCTCCTCTGCAGCTCACCCACCAGGAGTTCAGCCACAGCAGCCACCATATACAGGAGCTCTGACTC
AAGCAGGTCAGAGTGAA---CAGATGTACCAGCAGTACCCGCAGCAGGCTGGCTATGGCACTCAGCAGCCACAGGCGCCGCCCCAGCCGCCACAGCAGTA
CGGTATTCAGTATTCA---GGCTATAGTCAGCAGACCGGACCCCAACAACCTCAGCAGTTCCAGGGATATGGCCAGCAACCAACTTCCCAGGCACCGGCT
CCTGCCTTTTCTGGCCAGCCTCAGCAGATGCCTGCTCAACCACCACAGCAGTACCAGGCGAGCAGTTACCCTCCACAGACTTACACTACCCAGACTTCCC
AGCCTACTAATTACACTGTGGCCCCTGCCTCACAACCTGGAATGGCTCCAAGCCAACCCGGGGCCTATCAGCCCAGACCAGGTTTTACTCCACCTCCTGG
AAGTACCATGACCCCTCTTCCAAGTGGGTCTAACCCTTATGCACGTAGCCGTCCTCCCTTTGGTCAGGGCTATACCCAACCTGGACCAGGTTACCGATAA


>BGISUSP0000897204
MNGQLDLSGKLIIKAQLGEDIRRIIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKDE-GDLITIFDSSDLSFAIQCSRILKLTL--NGQPRPLESSQ
VKYLRRELIELRNKVNRLLDSLEPPGEPGPSTNITEN-TVDGREEKPAASDSSGKQSTQVMAASMSAFDPLKNQDEINKNVMSAFGLTDDQV-PPSAPAE
DRSGTPDSIASSSSAAHPPGVQPQQPPYTGALTQAGQSE-QMYQQYPQQAGYGTQQPQAPPQPPQQYGIQYS-GYSQQTGPQQPQQFQGYGQQPTSQAPA
PAFSGQPQQMPAQPPQQYQASSYPPQTYTTQTSQPTNYTVAPASQPGMAPSQPGAYQPRPGFTPPPGSTMTPLPSGSNPYARSRPPFGQGYTQPGPGYR*